CAZyme Information: MGYG000000666_02501

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02501
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		77140.99	9.651

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 4141; End: 6153 Strand: +

Full Sequence      

MKSGWFCIALCCLLSAFFPLGAEEAVHWDRENLKVSWKKKISVSADSGGGVTAEFRTGSN
PWPYFVLVPEKGKNWDFSRFRFISFAIENLDRERAVTGDICLGMWSRHKIGVFVLGPGEK
RSFTYPLNHGGRSSFDPLFRAKGMPNGFEGGTNIDTSSVKCIHVICGFVRYGRFRISGIR
LHGRYAPSPAIRSPETFFPFIDDYGQYCHEEWPEKIKSNRQLKESLRNEKSALKPRVADW
DPWGGWKSGPRLKATGYFRVEKWEGKWYFADPDGRLFFSRGVNAWSRGEYWPTDRGKAKC
YTRKSAAPGRVFHFYSDNCRIRYGNESWHDFQFRRMESWGYNTIGNWSDPALYRKRKMPY
MLNLPLPSRKAMRFGPKNEFRDVYSPEFESELLNVLPEKFRWTIEDPYCIGYFVGNELHF
GSSVEVAEAAFLASAELPAKRELIAGLRKKYGTIAALNKAWKGSWPSWDALACVETLPDA
KGCRADFEAFSLKFWKRFFELSRQAVKKHAPHHLYLGSRFKVQDYNKQWLFRMASESCDV
VSINDYALHHDHSVYAGLGDKPVLISESSVGHRMRGMPGILAYPGCAPHVREEAQKILLE
STARHPLIVGIHHFCFKDQTLIGRWDGENYGIGLVSVTDEPYRAFVESNRAFSERLYPFR
RNAEPVRIPR

Enzyme Prediction     

No EC number prediction in MGYG000000666_02501.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	304	657	4.9e-75	0.5712098009188361

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	0.001	447	572	158	302	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45357.1	3.44e-115	12	664	18	677
AHF89577.1	1.49e-109	67	660	69	688
AHF89585.1	3.61e-108	69	660	64	680
AXP07841.1	6.74e-103	59	660	73	691
ASV75458.1	1.04e-100	19	660	12	681

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	4.84e-57	184	657	188	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.24e-56	184	657	188	743	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.49e-56	64	660	76	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	4.14e-54	35	657	43	759	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	7.64e-59	18	660	240	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	8.91e-43	264	657	467	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000717	0.998354	0.000344	0.000189	0.000186	0.000191

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_02501.