CAZyme Information: MGYG000000666_02684

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02684
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1092		122527.01	9.6553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 4130; End: 7408 Strand: +

Full Sequence      

MGKINSWIVGALLLSSGCAFCASLGEVFGQNDLKTAWGNASIARNADGSVRLISNNAEGA
AALIAGTPEVPENAQCRFSMEVRGNVRFQTMLRFSEGARTRRVDIVMPTPLTGEWQKIER
SFTVPPGFRKILLDFLIWKQTGYAEIRNYKLEIPLWRKEVTIFRSDFQKGALIRNRYHTR
IPAFWWEFRSQDAPKGEIGGLDDAVSLIPKGKSLRIPAASRGWWGWVSFDTALPKEKRAM
TLRFRYYLSPDFSGNEIQARLVFRKNKKEDLSQIVWRLPVTEKGKWVTAEYRVDASRIPE
KAVGFRIALQPGRIGTEAVRGSVWFGEATVTIPENDGAFARIRCDRDLCWYSLGETVRFR
ALGELPSNTSLVLGKIRRSDRSPVAEVRVNADKMTRNGWTWTPKEPGYYEVEFFAETSAG
TVPLVEEFAERAGDGRIGLFGNSVLSFAVIDRKASSKKSELFGYQTFFHPWQMQRFGDRD
FRVARTVGAQYLRFGASWSLLETAKGKFDWSLLDSYVDLCVRSGLKPLLGLSSTPRWASS
HPEDDRWVICVWGYTGWAPRELRDWENFIEKTVSRYRNTVTDWEIWNEPNLPGVSCFWHD
SPENFVRLLKSAYRTIKRIQPASNVLGSGYSDRYLTFYEQIIRLGAGEAFDTLSIHGLNS
TIPAFRAIDRKYNSPKHRVFNSEWHWGLLRHDYPTMNASEEALALTMMKGLFSMLANGVE
GISIFEPVNMAEKETLKLHAAGGDPLTHTSGIFRGKPRLQPRLVAVILANLSGRYLTGIP
KVEAMYRVGTFQSVLLRTADGPYLAFWQEGKNPVALPSSLASAVAGCRIGDWEGRTVAAG
EKGSFVPEVVYFARAPRIPADWKNDPSMLEEKESSRPLRHDVAGVYSRKPILTGKGVPIP
ENIRWNSNFSVYPLGQLPAGFARPTRFAAAVTKDRFQLIVETDDDLHHPEVDGRDLWRGD
SLEFSLDIPGKGMNASTVGFSAARIPGGKNLMYKGHVPVVVGDCPTVWTPASMPVETGRC
EVLVQPEKKKTVYRIDLPLTELFPYIPKSGDPIRFSLLVNENNGKERIAALCWGGGIVGG
KDAAKYGDLKAE

Enzyme Prediction     

No EC number prediction in MGYG000000666_02684.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	503	669	5.9e-33	0.38979118329466356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	1.99e-26	926	1090	42	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam02449	Glyco_hydro_42	1.46e-10	478	641	13	187	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam01229	Glyco_hydro_39	4.27e-06	508	635	74	203	Glycosyl hydrolases family 39.
cd00241	DOMON_like	5.43e-05	925	1073	20	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
COG3693	XynA	1.95e-04	498	631	69	195	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45605.1	5.50e-269	8	1089	4	1091
BBH20281.1	2.84e-118	128	1089	10	972
AVM45582.1	2.17e-110	350	1089	33	781
AHF94113.1	6.55e-100	350	1090	231	983
BBH24554.1	1.99e-97	213	1089	253	1135

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	5.12e-09	478	631	119	259	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]
4ZN2_A	1.79e-07	487	629	45	179	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.79e-07	487	629	45	179	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001391	0.197691	0.800347	0.000168	0.000221	0.000184

TMHMM  Annotations     

start	end
7	29