CAZyme Information: MGYG000000666_02731

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02731
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		67701.32	6.256

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 515; End: 2281 Strand: -

Full Sequence      

MSTHIFHAGGLQFELEGEFSGWTIDFQEEVRETGLSLLHFELRSESERSLPQLALTFRWP
QKDIQVRWTPEMPANHHLLPYWWNGGNIATNLCRNAPVFSYLNLEGENRITYAFSEVEQQ
VLTHTGPTENSYLINRIQCFFHPLPPVRKKRISLRFDRRKIHYSEALHDVSLWYEEILPH
PPLPVPAAARNPVYSTWYQFQREVTAKQIEQELPVARECGLSTFILDDGWNYAGATVPGT
FAHTGDWKAAPEKFPDMPGHIQKAHQEGMRYLVWFPVPFIGRLAKEDFARFQGKFLSKNS
HYGTLDPRFPEVRSYLEELYEHFVREWNLDGLKLDFLDNIQLPEPDPAANDDAGRDYRSL
PDAMEALLSGIRTRLCRIKPDLLIEFRQKYIGPAMRAYGNIFRASDCAMDLLENRVRILD
LRLLSGGTAVHSDMLIWSPEDTPEVAALQILNVIFATPQISCMLTELPADHRKMLKFWMN
FCMRHVRTLQESPIRPEHPELSYPLVSAKGDEEVITAVYLTGQQIRIHPEKRHIILNAKH
SEEILIETGSPLAIRRFNVFGEEISPESLPAGLHRICVPPSGFALCDN

Enzyme Prediction     

No EC number prediction in MGYG000000666_02731.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	185	518	5.8e-28	0.4956395348837209

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.85e-56	189	481	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	7.55e-10	190	336	1	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	5.03e-08	216	385	67	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.92e-07	162	406	269	505	Alpha-galactosidase [Carbohydrate transport and metabolism].
pfam02638	GHL10	6.44e-06	261	384	76	225	Glycosyl hydrolase-like 10. This is family of bacterial glycosyl-hydrolase-like proteins falling into the family GHL10 as described above,.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	1.62e-141	12	583	9	582
QTH41069.1	9.28e-140	13	585	12	587
CQR57728.1	1.17e-134	4	582	2	583
ASA19679.1	2.40e-134	7	583	9	588
QJD86820.1	8.35e-134	13	587	9	601

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_02731.