CAZyme Information: MGYG000000666_02936

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02936
• CAZy Family: GT112
• CAZyme Description: Glycosyltransferase TibC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	MGYG000000666_237|CGC1	50481.55	6.1876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 4466; End: 5794 Strand: +

Full Sequence      

MTENNFSFTPMANEDISIHIGSVPGAVAESGAPAASASPVSAQHQEAESIFGEIPAVPTQ
EAVDGILFDFNDGIRILFPQNRKEYHVVFSDIETGVILFSQDTVSGAFITSVKKFYICFR
LVIYEKGGKEPLFTHDFDARDKEVMIQIPVGTLGDSIGWFSYVERFQQKHRCKLICVMNQ
WIIDIVKNQYPDIVFITPAQTKNYKPYACYHMGLFFRGDVDHQPIDFRYIGLHRTAGYIL
GVDPADEPPRFDLSAPRRIREKYVCIACQSSSQAKYWNNPYGWDEVIKFLKDNGYRVFCI
DKERVHGAGLVWNHMPWGVEDETGDKPLQERIDLIKDADFFIGLSSGLSWLAWGCKVPVV
MISGFTHPTNEFTTPYRVINYHTCHSCWNDMRLDFDHFDFLWCPRHKGTDRHFECSKLIS
AAQVITTIKKIPTFQPLQVESL

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT112	57	430	1.2e-171	0.9973262032085561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04414	hepto_Aah_TibC	0.0	55	431	1	374	autotransporter strand-loop-strand O-heptosyltransferase. Both Aah (autotransporter adhesin heptosyltransferase) and TibC (tib is enterotoxigenic invasion locus B) are protein O-heptosyltransferases that act on multiple sites from repeat regions of proteins exported by autotransporters. Aah glycosylates AIDA, or autotransporter adhesin involved in diffuse adherence, TibC acts on TibA, but TibC can replace Aah. [Protein fate, Protein modification and repair]
cd03789	GT9_LPS_heptosyltransferase	1.42e-23	246	430	107	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	6.98e-11	214	431	120	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.47e-09	240	376	76	220	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM43209.1	1.14e-266	43	440	36	433
AVM45539.1	3.53e-246	24	435	15	425
AVM43989.1	2.44e-179	43	431	21	410
ARQ79249.1	2.74e-173	55	431	3	376
ARQ46048.1	3.20e-173	38	431	20	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RB4_A	4.60e-159	55	431	13	386	Crystalstructure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_B Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_C Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_D Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_E Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_F Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_G Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_H Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_I Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_J Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_K Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E],4RB4_L Crystal structure of dodecameric iron-containing heptosyltransferase TibC in complex with ADP-D-beta-D-heptose at 3.9 angstrom resolution [Escherichia coli DEC13E]
4RAP_A	5.29e-158	55	431	13	386	Crystalstructure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_B Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_C Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_D Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_E Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_F Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_G Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_H Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_I Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_J Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_K Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407],4RAP_L Crystal structure of bacterial iron-containing dodecameric glycosyltransferase TibC from enterotoxigenic E.coli H10407 [Escherichia coli ETEC H10407]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9S4K6	1.54e-159	55	431	13	386	Glycosyltransferase TibC OS=Escherichia coli O78:H11 (strain H10407 / ETEC) OX=316401 GN=tibC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985870	0.014089	0.000028	0.000016	0.000011	0.000018

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_02936.