CAZyme Information: MGYG000000666_02998

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_02998
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		52169.44	6.5049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 1222; End: 2631 Strand: +

Full Sequence      

MERLKKTGMVKAVNSAQVGESVLGLGFEKLDRGVFDPEKAYDKVAELGIKWIRIQSGWAR
TEGKKGGYDFAWFDSIVENLLRRGLRPWVCLCYGNGLYDEAARKVFGAVGCPPIHTEEQK
KAWHDYVVAVVTRYKGKIGWYEVWNEPDGKSCWKHGASGTEYGEFVNATAKAVREADPQA
KVVGGVIFLHDLRWVRDMLETGAGANMDALSYHGYSPDERGAIERMHAVKALCLRYNPAM
EFIQGETGTQSRRDGAGALRGAAWTPLRQAKFLSRHMLAHMFEKVRFTSYFSCMDMIEAL
NGTVGNKASYLDFGYFGVLGADFDENGVATGVYTPKPSYRALQVLASIFREEYSLADLPV
RLAPEGSPLLMRDEDPARTLMSGGFTKPNGSSAFVYWTPSELLTTTYEATMTIEVCGVKG
EAHLIDLLDGSIYAIPDNMVEDDGKNYRKFLHLPLRDSPLLLTFGSFAE

Enzyme Prediction     

No EC number prediction in MGYG000000666_02998.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	61	221	4.3e-35	0.3874709976798144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	3.55e-17	46	346	45	348	Glycosyl hydrolases family 39.
pfam02449	Glyco_hydro_42	7.66e-07	38	96	13	70	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd21510	agarase_cat	1.55e-06	125	215	81	187	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
COG3867	GanB	2.79e-05	114	215	145	255	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam00331	Glyco_hydro_10	4.20e-05	58	181	46	164	Glycosyl hydrolase family 10.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYY35369.1	1.29e-217	1	468	1	474
AVM45335.1	6.95e-217	1	468	10	478
AWI10371.1	4.21e-162	3	469	60	530
QNN22730.1	4.97e-66	4	463	47	479
ASV73290.1	2.48e-65	8	463	71	522

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	1.93e-12	35	397	30	368	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	1.93e-12	35	397	30	368	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]
1PX8_A	2.38e-11	68	216	77	231	Crystalstructure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1PX8_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_A Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_B Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_C Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum],1UHV_D Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase [Thermoanaerobacterium saccharolyticum]
6YYH_A	9.65e-10	68	216	100	254	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O30360	5.58e-11	68	216	77	231	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	1.24e-09	68	199	77	212	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_02998.