CAZyme Information: MGYG000000666_03074

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_03074
• CAZy Family: GH63
• CAZyme Description: Cytoplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514		58701.91	6.7277

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 1319; End: 2863 Strand: -

Full Sequence      

MKKEFSPSTEWKSQIPRPVCTEHPEFTELYDKAWELAHRHILEIPGMPQTPYMDEAFCDT
DIWIWDSCFMALFCKYAQNRFPGVETLRNFYEVLYNGARLPEIVSHNAPSWTGVMPGQRT
RMVVHMMDNPPLFAWAEYQNALFSGDREHVADLLLKKRFLQKHFEALESLKTRIRLPGVR
SETCWIKHPNGYFWEGGRSGMDNTPRGRIGKHARENRPNNPDMLWIDAIAQQGLAAFCIA
KLAGLIGERVLAEEWNARYEAIRKSVNACYWDEDDGCYYDIGATRGEFMKVLTPASFWPL
VSGMGTPAQAAAMSRLLTDPEKLGGVVPLVSLARDDADFNREDGRYWRGSVWVPTAYAAI
KGVERYGMYPLARELSGKILTHMSETFRQYEPHTIWECYHPERPEPARSCDEANRIVRPD
FCGWSALAPIGLYLENVIGIHSVNAFAETIDWSLPHRFSGELGVRNFRFGEIVTDLIATE
NGRRIRVTASRPFTLRINGQRFPLPAGESVLTPA

Enzyme Prediction     

No EC number prediction in MGYG000000666_03074.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.94e-15	239	402	591	759	alpha-glucosidase; Provisional
PRK13270	treF	3.91e-15	239	400	362	512	alpha,alpha-trehalase TreF.
pfam01204	Trehalase	1.02e-13	239	403	318	477	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	2.15e-13	237	404	365	522	Neutral trehalase [Carbohydrate transport and metabolism].
COG3408	GDB1	9.01e-12	242	442	433	612	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44762.1	1.08e-236	1	508	85	590
QZT38129.1	2.52e-159	16	509	33	498
QWO96172.1	5.72e-140	8	512	38	511
QWP70936.1	5.72e-140	8	512	38	511
QWO91044.1	5.72e-140	8	512	38	511

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	1.74e-11	63	390	32	394	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3W7S_A	2.23e-11	239	382	564	715	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7W_A	2.23e-11	239	382	564	715	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7X_A	2.23e-11	239	382	564	715	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	2.42e-11	239	382	113	264	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	1.52e-28	67	508	59	466	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	1.24e-10	239	382	587	738	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
B5R404	2.14e-09	239	435	362	548	Cytoplasmic trehalase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=treF PE=3 SV=1
Q8ZLC8	2.14e-09	239	435	362	548	Cytoplasmic trehalase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=treF PE=3 SV=1
B5FKM4	2.14e-09	239	435	362	548	Cytoplasmic trehalase OS=Salmonella dublin (strain CT_02021853) OX=439851 GN=treF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999500	0.000497	0.000020	0.000002	0.000001	0.000010

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_03074.