CAZyme Information: MGYG000000666_03098

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_03098
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
893		100912.79	9.4458

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 2614; End: 5295 Strand: +

Full Sequence      

MFRGTLPPEFDHLKGVVTASDGTTAAERTVARKELEQNGWSCRLSRPGFYTVRFFYENSS
GETVPVVQEYYAQRINGNRLVEERKFEREIQNFVVTATKARPVEQVPPQLGISLAPRDVA
LPYRLGSNIADDFRMRRLIGYHFMRLHALSWDEIEKSPGVYDWSIADKMFETAARNGIPQ
SRIDVVLLDTPRFYTNRPDNTAEMSYSARYQFYPPNDWGAWERFVTAAVKRYPQVRSWEI
WNEPHLPGHSIFWKGTPEDYRKMLEIGYRAVKKASPGKPVAFGGVGMRYQAFYRRILELG
GGRFFDILPLHGTWADPEPYVRIGKEFNAGSKQYVNNEWHLTLFTSSDPVILSEEQLSFN
MVLDFLNMFRSGIEKAAFHNGFGPRWHGGTEREMAEFRRPEGAQIEGIFRTFPNQEPKFA
AFVLRNLYDRFSGHIQFRGAYTFGSGDVQAAVMESASGPLLIFWNMGKNAAPLPTALVPA
LRSARVLDWEGRPVKNPPSMRLAPQVVYYAEKPELSGSGTWSVLSRIEPYQESEEMEYRF
RGSYQEKNLFSDGWNLRKDLRWIPLTEYFSLIPSGRPSSYGGRFAVSLNPSGLELCVEVR
DAVHTPVPDHERGKPIPYWMGDSLQFAIDCEGKGQRRSMTEFIFSSHNHFLSKVMMASVG
GDIPERLTQPGEVLKYGAGIVERRGDLTIYKLRIAASELYPFTLDPGKPRPLRFSLLVNN
NDGSGRVGYLTWGGGIGDRKSPAKFGTLALQGSGRTLAVQKDLRNRFQQSELSFDSAAGT
VKVVSTLKQKQGAVPMAGSGIASVPVNVVPGMVYQVSCEVRGTGRLEAFLAGKGIPRWNF
PGTPLNLTASFVPLTGEIQIPLEGETMQCFLFTWRQIGTSFEVRNFRIREKTE

Enzyme Prediction     

No EC number prediction in MGYG000000666_03098.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	136	325	1.6e-28	0.45011600928074247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	4.92e-30	556	750	5	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam01229	Glyco_hydro_39	3.57e-07	139	298	46	209	Glycosyl hydrolases family 39.
smart00633	Glyco_10	1.34e-05	151	276	3	121	Glycosyl hydrolase family 10.
pfam02449	Glyco_hydro_42	1.75e-04	129	292	12	184	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
cd00241	DOMON_like	0.002	563	732	1	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45582.1	2.78e-153	8	888	49	915
AVM45605.1	2.83e-111	3	752	367	1095
BBH20281.1	2.72e-100	4	746	238	970
BBH24554.1	5.57e-97	3	762	398	1149
AHF94113.1	8.97e-96	6	748	247	982

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZN2_A	3.39e-14	139	355	45	250	Glycosylhydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_B Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_C Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],4ZN2_D Glycosyl hydrolase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5BX9_A	3.39e-14	139	355	45	250	Structureof PslG from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],5BXA_A Structure of PslG from Pseudomonas aeruginosa in complex with mannose [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_03098.