CAZyme Information: MGYG000000666_03157

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829
• CAZyme ID: MGYG000000666_03157
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450		50104.83	6.0627

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000666	4523435	MAG	Kazakhstan	Asia

• Gene Location: Start: 3000; End: 4352 Strand: -

Full Sequence      

MAKIVLVGAGGVIFARNFMKDILLDPVLRTNQLTLMDINAERLENSATICGLIASKLNLD
FHPEKTTDLRKALAGADYVITIFRSGTIDHQALEYSIPAKYGVQQVVADSLGPGGVFRGL
RTLKDLFEVLDTMEEVCPGAYLLNYVNPMSMNTIALSRRARTVRVIGLCHSVQGTSRQIA
DWLKIPYEKLHYYAAGVNHQAFMLKLEAEGRDLYPELRKCLDNPEIYKRDKVRFELLRHF
GYFPTESSGHGSEYIPYIRKRQDLIDKFCSNDFPKIEDGIDWNTMGAGVSGASVSICRVL
QHRNEKDLRGYLDGSKEIDLKPSLEYGVQVIAAIEKNLPLAANLNVMNHGLIPTLPPECC
VEVPCLVCGGGIFPGRIENYPEQLANLNRGMINVQIIGAQGALTCSRRDIFYAVAADPLT
QAVLGLDEIQAMVDEMFEALRDQIDPKFFA

Enzyme Prediction     

No EC number prediction in MGYG000000666_03157.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	3	182	4.8e-57	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15076	PRK15076	1.53e-177	1	449	1	431	alpha-galactosidase; Provisional
cd05297	GH4_alpha_glucosidase_galactosidase	7.52e-159	3	437	2	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	6.60e-118	3	442	5	434	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
cd05296	GH4_P_beta_glucosidase	9.66e-57	3	442	2	417	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.
pfam02056	Glyco_hydro_4	3.38e-54	3	183	1	181	Family 4 glycosyl hydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44903.1	5.71e-252	1	448	8	456
BAJ62916.1	1.04e-124	1	448	1	442
ACI18714.1	5.87e-120	1	444	1	425
QIN85178.1	5.22e-119	1	439	1	427
ADQ40601.1	6.30e-119	1	449	1	437

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	1.09e-42	28	449	31	438	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	8.82e-36	28	449	34	441	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
3FEF_A	3.74e-33	3	421	7	422	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1U8X_X	1.24e-25	32	442	59	459	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
1OBB_A	1.64e-23	3	436	5	464	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P06720	6.36e-91	3	442	6	443	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
P30877	3.44e-87	3	442	6	443	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
O34645	1.18e-82	1	442	1	426	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9X4Y0	8.69e-63	3	439	5	434	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
A9KTB9	8.52e-43	3	441	12	457	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000666_03157.