CAZyme Information: MGYG000000667_00163

Basic Information

• Species: UBA7173 sp900546835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900546835
• CAZyme ID: MGYG000000667_00163
• CAZy Family: GH97
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1272		141356.4	4.6166

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000667	2502097	MAG	Kazakhstan	Asia

• Gene Location: Start: 208727; End: 212545 Strand: +

Full Sequence      

MKNLILSWLGLAAIASASAETAPVWEMESPDGNIKVAIGQNNATPVFNVSYQGKEVCAGD
LGLFTSDADFSRNLQLKSPGTTESFTETYDLVHGKKKSVSNSGNRRTASFSNADGDEIEL
EVKVFNDGLAFRYVMPNPDNKKITFTGEATSFTFPADAPRWMQKYVTSYEGDFPRQNGAT
ASGEWGYPALFEASEGVFTLLTEAGTSRMYCATHLSNSAESRTYTIAYPGAGEGNGIGAV
NPVWTGKWESPWRVLIIGNLNDIVESTLVEDVSQPCVVEDTSWIEPGRAAWVYWAYNHGT
KDFKICQSYVDLAAAMGWEYVLFDWEWDEMGNGGRLEDAVKYALSKGIQPLMWYNSGGPH
NGVGSTPRDRMLTHESRVKEFTWLRSLGVAGVKIDFFESDKQDMMNYYLDILEDARNFNM
LVNFHGCTVPRGWHRTYPNLISYEAVYGAEQYNNSSFMTSNGPRINCLLPFTRNVVGPMD
YTPVAFTNSQNAHLTSYAHELALSVAFQSGIQHWADRPEGFLGLPESARRHMQRVPATWD
ETIFVDGYPGESFVVARRKGDVWYLSGIVGENRERDMELTLDFLDDGKTYNATVIADGPT
SESFRFSHMDCRKGETLTLHCLGYGGFTVVFGENADRSLEELRELISRATQALASVGDNI
GETTGTYDRIVVDALTDALADAGKVKETDGAAIISQAYDNLMDALCNFQSFAFLAPGCVP
DKHRTMNVTRKYLVEARNFSRSDTGTGTSTRFGLLGEPWQYTPNIVNMDNFTHGGFDSFE
GGKYISIEKYDDGLPAIRNGLLFQTSKKALPKGEYSVKLYVTSNYGFEKGECMFNIVAGN
DFNPALTPLSVYDCSDRSGWVWNWVDAGTFTVADDSRITIGWLVNIAAANSGRSVRFSDL
RLYDSSGKDVTVTFFDNYREYTRKDISPLRFGKPTNWEVADFYIPNGDDGVKQGIDRYPG
YNCLTLGVWDDSHNASGNLAGSAIYRKVSLPAGRYFFGSSYYNIWDVRKAYLFVADLPLA
ASEVEDHAIAWHSVPEAAANDLWQGVTFNLDTDSDVYLGWCADLTTRGQQEFRVKEVALL
RYMEKEGEWIEAEAPLLDGEHTFTAMECAEQNGAANVFSSDGRGLLRANAGSDIVVGHIN
TTGVKDITVNANSPFEINESTSISLITDNKDVWATVPFRESNTSSYQSYHFDRLPELNGV
HQLAVRFNNISANLWDVVIKAENSGAGTISTEEDSFDSIPIYYNLQGMRVVHPTPGLYIV
REGDKTYKRLVR

Enzyme Prediction     

No EC number prediction in MGYG000000667_00163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	22	630	1.2e-181	0.9793977812995246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	1.62e-79	280	536	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	7.84e-55	29	275	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	7.99e-30	539	631	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
pfam16405	DUF5013	1.04e-08	737	881	5	145	Domain of unknown function (DUF5013). This small family of proteins is functionally uncharacterized. This family is found in various Bacteroides and Parabacteroides species. Proteins in this family are around 400 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68456.1	4.16e-230	29	627	29	626
QNR85647.1	5.38e-228	60	633	67	643
QEC79490.1	4.01e-224	27	627	29	637
AEV98766.1	1.89e-211	1	627	1	635
ADF51376.1	2.07e-207	60	631	65	636

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	6.04e-102	27	589	19	603	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	8.97e-58	29	629	6	638	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	9.21e-57	29	629	20	652	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	1.39e-48	27	602	3	623	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	3.34e-48	27	602	3	623	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	1.10e-83	1	630	5	619	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	1.09e-58	6	629	4	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	1.03e-41	5	638	9	730	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000230	0.999090	0.000159	0.000165	0.000150	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000667_00163.