CAZyme Information: MGYG000000667_00411

Basic Information

• Species: UBA7173 sp900546835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900546835
• CAZyme ID: MGYG000000667_00411
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		70514.92	5.9349

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000667	2502097	MAG	Kazakhstan	Asia

• Gene Location: Start: 205247; End: 207118 Strand: +

Full Sequence      

MKLIFTALALSVALCAHAGAELSISSPDGRNRVTFSKPGRELTYKVERDAAPLILPSRAG
LDLDNRVWEMALGKRTLAQPDCWMDLLEADSITVNAPVDSVWTPLYGERSSVRDHFNSAT
LHLSRKDKSDYRLDVEVRAYNEGIAFRYFFPEHPAAIFHKVVEDLTDYTVPEGTKAWSEQ
WAQATFDVGPVDSISRPAERALTMELPQSRWVALLDADVDDWSLTKLQARPDKPSTLRSV
MYSPVDVVTYCATPWKIIMTADTPGQLIENNDIVLNLNPERSGDFAWVKPGKIMRSPIST
EMGLKTIDFCADHNIQYMLYDWQWYMPCTSHDGDATKVIPTLDMQRVIDHGRERGVGVWL
YVNQHALMKQMDELFPLLHQWGVAGVKSGFVQYASHRWATWLHDMVRKAADNGLMMNIHD
EFRPSGFSRTYPNLLTQEGICGNEEFPDATHNTTLPFTRMLNGAADYTICYFDKRLRNTH
AHQLAASLVFYSPLQTIFWYDNPTRYNGEPEISWFEKLETVFDESHVLAGYPGEGITMAR
RKGDTWFVGVLGNNDAREVVVDFSFLPTSSVWNATVYSDGGDKVDTATHVKIDTRKVRPS
DRMRFALQPRGGVAIRLEPVAGK

Enzyme Prediction     

No EC number prediction in MGYG000000667_00411.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	12	617	7.8e-161	0.9904912836767037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.61e-64	284	515	1	273	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.37e-56	26	279	1	234	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	6.93e-36	522	617	1	96	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62032.1	3.49e-314	8	620	11	631
QUT92217.1	9.98e-314	8	620	11	631
QDO69864.1	2.85e-313	8	620	11	631
QUT34121.1	2.85e-313	8	623	11	634
QUU00177.1	5.75e-313	8	623	11	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E1Q_A	5.98e-60	26	618	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
3A24_A	4.55e-59	26	618	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
3WFA_A	9.59e-50	24	623	5	709	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	9.68e-50	24	623	14	718	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	1.08e-49	24	623	25	729	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	7.57e-61	2	618	3	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	3.60e-50	8	623	7	729	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
D7CFN7	1.08e-40	7	614	19	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000485	0.996855	0.001966	0.000257	0.000207	0.000195

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000667_00411.