CAZyme Information: MGYG000000667_00883

Basic Information

• Species: UBA7173 sp900546835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900546835
• CAZyme ID: MGYG000000667_00883
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41407.05	9.475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000667	2502097	MAG	Kazakhstan	Asia

• Gene Location: Start: 75158; End: 76267 Strand: +

Full Sequence      

MRYFISAGEASGDLHAGALMREIRRRHPDAEFTFLGGDHMADAAGSAPLIHMRDMAFMGY
WQVLKNLRKISRNLRAAREAIASTRPDAVVLVDYPGFNLKLAAYAHSLGIPVYYYISPKV
WAWKEWRVKDMKRYCTKILSILPFEEEYFRGKGLDVEYVGNPSVEEVDARVASIPSREEF
IDRWRLAADRPILALVPGSRRSEIAKNLPIMDEVARRHPEFQAVVAGAPAIDRALYRDFT
TLPIVDDATFELLHHATCALVTSGTATLETALLGTPQVVCYRGNGTRATYSIMKRLLKIP
FVSLPNLIAGREIVKELLLYLCTPDTVDAQLCRILPGTTGRDEMMRGYARMRSRLGNLNA
PRRAAALLP

Enzyme Prediction     

No EC number prediction in MGYG000000667_00883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	355	1.6e-113	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.81e-122	1	365	2	368	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.35e-113	1	368	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.82e-87	4	331	2	335	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.05e-70	1	368	1	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.38e-61	1	318	2	300	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	3.59e-145	1	368	1	370
QQR08529.1	3.07e-140	1	368	1	370
ASB37800.1	3.07e-140	1	368	1	370
ANU64105.1	3.07e-140	1	368	1	370
QCP71596.1	1.88e-132	1	353	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	7.34e-41	7	335	13	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	7.34e-41	7	335	13	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	3.51e-80	2	365	6	371	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q02AZ6	1.12e-71	2	365	3	366	Lipid-A-disaccharide synthase OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=lpxB PE=3 SV=1
Q2IL69	8.10e-69	5	365	13	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	1.61e-68	5	365	13	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	8.95e-68	5	365	13	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000667_00883.