CAZyme Information: MGYG000000667_00965

Basic Information

• Species: UBA7173 sp900546835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900546835
• CAZyme ID: MGYG000000667_00965
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		73833	5.403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000667	2502097	MAG	Kazakhstan	Asia

• Gene Location: Start: 32824; End: 34851 Strand: -

Full Sequence      

MKTATLAFFVTTSLLTALIAATPQAGAALKTFECGQWSLTVDTADGSATLSLDNRPVAVG
VGAEWGLDSVVATMKGMKNITASSRPFADKFGNGMKVAVAGRDGKLTATRTFRLYEGKPY
AIADLTVADSAGVEANYMAPVACASTFEAFSRPGNSTVFVPYDNDAWVRYSITPFGESMP
VSYEVSAILNADTREAIVVGSVEHDVWKTGVRTVAKGATAIDSLYAFGGVATNLTRDIRP
HGAVKGKSVKSPAIMLGRFDDWRDGMETYADLCAIEAPRIQSAGPRPFGWNSWGKLQTRV
NFENANQVGEFIAEKLEPESFVNADSTVYIGLDAFWDFGLTEQQRIDFAKACHDRGQKAG
IYFCPFTDWGKNPEATVGEAPEYKYKDIYLRHGDKILEFDGAYAIDPTHPATRARIARQV
QQFIDWGYDFMKIDFMAHGAYEADSHYDPSVTTGVQAYNSGMAFIDSVAQGKLWINLSIA
PLFPANYAHSRRIGCDAWADINNTEYSLNALTYGWWLDHVYHYNDADHIVMEGVTDGENR
ARLTSSAITGLFLLGDDLSEVSGKPATRAKVLRTATNPDINAIARACKSFRPVEPGKGDR
AADMFVGRDGDTMYVAIFNFSDRSERKHLPLHRLGLSDGADYQAVELWSHDASTLRGAID
TEVPAKDVKVYRIAL

Enzyme Prediction     

No EC number prediction in MGYG000000667_00965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	418	651	3.8e-16	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.49e-17	285	562	1	283	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	2.66e-11	287	583	2	268	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	3.65e-09	609	673	13	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT74245.1	2.28e-191	27	670	12	652
QNL41291.1	1.04e-189	30	670	15	652
ALJ44661.1	4.11e-188	30	670	32	669
BCA52469.1	6.91e-188	30	670	16	653
QUT73244.1	1.16e-187	30	670	32	669

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.999070	0.000175	0.000174	0.000152	0.000148

TMHMM  Annotations     

start	end
7	29