CAZyme Information: MGYG000000667_01460

Basic Information

• Species: UBA7173 sp900546835
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900546835
• CAZyme ID: MGYG000000667_01460
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000000667_10|CGC1	86315.52	6.5184

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000667	2502097	MAG	Kazakhstan	Asia

• Gene Location: Start: 55507; End: 57840 Strand: +

Full Sequence      

MISRFFSSILNRFNSSLPARYAVAITILLPGAASGSDIVATKAYRWTGDSIIQGPFKAYA
PTPFRIVSDYSAQPGYYMGVEKEWNLKNDISEYPQLTTSNTLHNAIFNMGLDEMVNAIEP
DRTLRTGKEWPGVWTRDVSYSIILAMAALQPEVSRISLEHKITPNGRIVQDTGSGGAWPI
SSDRQIWGIAAFEVYKATGDKGWLNRIYPVIKNSLEDDYKTIYDPETGLVRGETSFIDWR
EQSYPRWMQTADIAQSEALGTSVVHAQAWRTLAQIARLMGENTEAQKYDARADALAEAIN
HQLWSDEKGYYNMYLYGRDNMIANPRAETLGEALAILYGVASPNRARILTEKNPTTPFGT
AIFYPQIADMPPYHNNSLWPWVAAYWTLANAKVGNERGVMQGIGSIFRPAALFATNKENF
VLDNGDIATELNSSNMLWCLSGNLAVTMNILFGIHYEADGIRFAPFVPKALADTRSLNGL
RYRDATLNITVSGYGSQIKDFYLNGKRQTPFIPADIKGENTIKIIMADNNAAPMRLNEVP
NLKAPLTPIAWLSNDPSVNNQMGPVNNLLQWNPIEYVNHYIVVRDGKPVAQTTETTFLAT
TPGEYQVIAVDANGTQSFASEPRSNATVHRFDFPGEKTAMSSDEAQNRLRTPLHGYRGSG
FVEMDHTSGSVNVPVEIGESGLYAVSLRYANGNGPVNTENKAAIRTLLVDGKRAGTIVMP
QRGAGNWNDWGMTNVVKVRLTPGRHNLSLVFLPENENMNFTVNHALVDQIELRRLRP

Enzyme Prediction     

No EC number prediction in MGYG000000667_01460.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	4.97e-15	655	751	22	110	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	2.63e-12	174	311	78	221	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04086	CBM35_mannanase-like	5.69e-10	655	750	21	105	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
COG3408	GDB1	9.88e-10	130	490	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam06202	GDE_C	1.42e-08	183	398	84	319	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE38578.1	5.27e-237	73	775	203	889
QNK61875.1	1.23e-232	84	772	216	888
QEC58493.1	2.53e-230	84	775	199	877
AKQ46615.1	4.93e-230	84	775	228	905
AWG27199.1	5.08e-230	81	775	212	893

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	2.19e-06	186	469	632	894	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.285826	0.703083	0.010119	0.000382	0.000268	0.000310

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000667_01460.