CAZyme Information: MGYG000000670_00189

Basic Information

• Species: Faecalibacillus sp900544435
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Faecalibacillus; Faecalibacillus sp900544435
• CAZyme ID: MGYG000000670_00189
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000670_2|CGC1	54763.2	5.1031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000670	2790604	MAG	Kazakhstan	Asia

• Gene Location: Start: 16446; End: 17864 Strand: -

Full Sequence      

MRKDFLWGGAVAAHQVEGGYNEKGKGLNVSDMMTVGGVDKRRKITDTILSDEFYPNHEAI
DFYHHYKEDIALFKEMGFKCFRTSISWARIFPQGDELEPNEEGLKFYDEMFDELLKNGIQ
PVITLSHFEMPYGLVKKYGGWRNRKLIDCFVRFAKVCFERYQHKVKYWMTFNEINNQANY
KADVAVFTNSGILFEEGEDREAIVYQAALYELIASAKAVKIAHEINPELMVGCMMAMTPI
YPYSCNPDDMLKAVGANHKRFWYLDVHARGIIPGYMKSFFERQGYDLDLNQEDLEALKQG
CVDYIGFSYYMSFATKGDGNINLDYDEENDLCDNPYIKKTQWGWPIDAKGLRYTLNWLYD
RYQLPMFIVENGFGAIDQKEVDGSVHDQYRIDYLKEHIQEMKKAVDIDGVDLLGYTVWGC
IDCVSFSTGEMKKRYGFIYVDKNNDGSGSLKRSKKDSFEWYKKVIETNGEVV

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	469	3.8e-150	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	470	4	474	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	470	6	471	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	3	470	8	475	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	3	471	6	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	470	7	475	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL57335.1	0.0	1	472	1	472
QUN12427.1	1.35e-303	1	470	1	470
QKN80918.1	1.59e-259	1	470	4	474
CCO09677.2	1.51e-257	1	470	4	474
ASV56402.1	7.12e-256	1	469	4	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	4.87e-235	1	470	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.39e-234	1	470	7	478	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	3.92e-227	1	470	7	478	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	3.14e-224	5	469	15	477	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	1.12e-221	1	470	8	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	6.13e-221	1	470	8	477	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.92e-217	1	470	4	477	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	2.37e-189	5	470	12	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	5.85e-174	3	470	6	471	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P11988	6.75e-167	5	469	8	459	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000670_00189.