CAZyme Information: MGYG000000672_00467

Basic Information

• Species: RC9 sp000431015
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000431015
• CAZyme ID: MGYG000000672_00467
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	MGYG000000672_3|CGC2	60373.82	9.4035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000672	2733599	MAG	Kazakhstan	Asia

• Gene Location: Start: 139927; End: 141525 Strand: +

Full Sequence      

MSLTLLLTFLFQGSAEAQIFKNKLKRENQELRARVDSLKKALTELKEASQHKDSIADEMI
EVYEENTVRTAAGLSPEDYTQEVTDSLLSIWYLHRQARQNEEGTGYAMDSVRFTSNVPDN
ELKARLEKMNSFITLPYNETVRNYMVLYSEKMPTKMSAILGLCQYYMPIFEETFSKYNLP
DELKYMAIIESALNPVAVSRAGAKGMWQFMFRTAKLYGLEIDSYVDERLDPVKSADAAAR
YLTDSYNVFGDWSLAISSYNCGSGNIIKAIRRNGGKRDFWSVYDYLPRETRGYVPAFVGA
MYAIRYSKEYGLVPADMRMPAQIDTFEIRRNLHFKQINELVGIPMEELRNLNPQYIKDVI
PGSGKTYILRIPYNYSNDFLANEDSLYTYKAAEYLNPQTLLCERRSDAEYSGGVITYKVK
KGDTLGKIAARYHVTVNQLKKWNHLRTTTLSIGQKIRIHKGGPAPAKTSSSSGKSSSSGS
SSPTDYTTYTVKAGDSLYSISRQFPGTTPEKIMKLNGINANIKPGMKLRIPR

Enzyme Prediction     

No EC number prediction in MGYG000000672_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	166	303	5.5e-26	0.8962962962962963
CBM50	417	458	9.8e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.26e-64	174	302	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	1.20e-63	166	528	104	444	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	4.42e-30	169	276	1	109	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK06347	PRK06347	4.99e-18	416	530	481	591	1,4-beta-N-acetylmuramoylhydrolase.
cd00254	LT-like	1.64e-17	186	295	5	104	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53188.1	1.32e-152	21	532	31	540
AZS28203.1	2.49e-126	85	530	56	523
QRO49268.1	3.15e-124	85	530	56	523
BAX79662.1	9.73e-122	85	530	91	562
ASB48875.1	1.69e-120	85	530	42	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MKX_A	1.81e-07	417	461	7	51	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
4UZ2_A	3.37e-06	488	531	4	47	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.99e-41	96	530	43	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.99e-41	96	530	43	442	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
Q49UX4	9.75e-14	416	530	87	193	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q8CMN2	1.33e-12	405	531	76	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	1.33e-12	405	531	76	191	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000473	0.998802	0.000176	0.000174	0.000164	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000672_00467.