CAZyme Information: MGYG000000672_01292

Basic Information

• Species: RC9 sp000431015
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000431015
• CAZyme ID: MGYG000000672_01292
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	MGYG000000672_11|CGC1	43757.33	7.3903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000672	2733599	MAG	Kazakhstan	Asia

• Gene Location: Start: 29788; End: 30948 Strand: +

Full Sequence      

MRYYIIAGEASGDLHGSNLMRGLYAEDPEADIRFWGGGLMDAVYKEHQQGTGLVKDYKDG
AVIGFTQILLHVRAFAKRFTDCTTDILRWKPDVVILIDYPGFNFRVAEFAHKAGFKVFYY
IAPKVWASRESRVKKLKAFVDKLFIVFPFEIPYFTEKGVDFIYKGNPLIDAIDNSEAFKE
TREEFLAKTGLPDRPMIALLAGSRNGEISSMMPTFMEFADRMHSIPEYSEYRFVVAAAPA
RSESDYTKYIRGREYVSVVFGQSYAVMRHAKAAVVNSGTASLECALIGTPQVVAYKGSDI
NFQIAKSIIKIQYISLGNLILDRICFRELLQYYFTPENVLNEVRRMIEDEEYRSTMLSGY
QKIRDALGGEGASAAVARAMIEELRK

Enzyme Prediction     

No EC number prediction in MGYG000000672_01292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	367	2.8e-106	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	8.55e-112	1	386	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.29e-104	1	386	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.11e-80	4	368	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.02e-61	5	382	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	6.61e-51	1	384	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY53532.1	5.46e-116	1	385	1	371
ADY31424.1	8.68e-114	1	385	1	374
SNV26174.1	8.68e-114	1	385	1	374
QKG80175.1	1.68e-113	1	385	1	372
BAX81022.1	3.62e-112	1	386	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	5.76e-35	5	339	11	337	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.95e-34	5	339	11	337	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	2.63e-75	2	383	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	7.04e-69	2	386	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	4.30e-67	2	386	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	1.01e-60	2	384	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	7.80e-60	5	386	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000028	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000672_01292.