CAZyme Information: MGYG000000672_01959

Basic Information

• Species: RC9 sp000431015
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp000431015
• CAZyme ID: MGYG000000672_01959
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272	MGYG000000672_21|CGC1	30886.57	6.7142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000672	2733599	MAG	Kazakhstan	Asia

• Gene Location: Start: 27812; End: 28630 Strand: -

Full Sequence      

MGKPVNRVLFVNSEIMPFLPETPLSRIGRCLPQGIQERKKEIRAFMPRYGCINERKNQLH
EVIRLSGMNIIIGDVDRPLVIKVASITSARIQVYFIDNEDYFRRKQISYDTDGKFFEDNG
QRAIFFARGVLETVKKLRWAPDVIHCQGWISHLVPLYLKKAYNGDPIFSGSRIVTSLYNE
AAEEKLSPSLKDNVLFGGIKPADVSLLEEPTGINLAKTAALYSDGIILGDKDVAPELVKF
CEERSMPILPFSEDSISSGRYIEEYDGFYQQL

Enzyme Prediction     

No EC number prediction in MGYG000000672_01959.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	7	227	7.4e-41	0.4449152542372881

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08323	Glyco_transf_5	6.38e-53	8	227	1	214	Starch synthase catalytic domain.
PRK14098	PRK14098	3.53e-45	1	247	1	255	starch synthase.
cd03791	GT5_Glycogen_synthase_DULL1-like	1.13e-35	7	226	1	212	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	2.91e-21	7	179	2	155	glycogen synthase GlgA.
COG0297	GlgA	4.27e-16	7	178	2	162	Glycogen synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKG78761.1	1.58e-108	1	272	1	268
SNV43872.1	1.18e-106	7	272	5	266
ADY34094.1	1.18e-106	7	272	5	266
QRO49825.1	2.00e-106	7	272	5	266
AZS31272.1	2.83e-106	7	272	5	266

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3EGV0	1.42e-39	7	238	7	236	Glycogen synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330) OX=290315 GN=glgA PE=3 SV=1
Q3B6C3	2.75e-39	1	227	1	236	Glycogen synthase OS=Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530) OX=319225 GN=glgA PE=3 SV=1
B4SC83	1.98e-37	7	227	7	236	Glycogen synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) OX=324925 GN=glgA PE=3 SV=1
B4S584	3.91e-37	1	226	1	224	Glycogen synthase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) OX=290512 GN=glgA PE=3 SV=1
B3QR00	7.25e-37	1	224	1	222	Glycogen synthase OS=Chlorobaculum parvum (strain DSM 263 / NCIMB 8327) OX=517417 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000672_01959.