CAZyme Information: MGYG000000673_01177

Basic Information

• Species: CAG-873 sp004552485
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp004552485
• CAZyme ID: MGYG000000673_01177
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249		28473.43	7.8722

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000673	2306526	MAG	Kazakhstan	Asia

• Gene Location: Start: 11292; End: 12041 Strand: +

Full Sequence      

MNEIPHIIHYCWFGRNPLPQWAKAYIDSWRRYFPGWEIKEWNEDNFDVNACLFTRQAYAA
GKYAFVSDYARFAILLREGGVYFDTDVEVVRSFRDILAAGPFMGYETDPGANGLPYGTVN
PGLGLGAVPGMEIYREILDRYESISFMDENGRQMEGTVVYHTTEVFRKHGLLPDKAPQTV
ASVTIYPARFFNPFCDADGKLHLTNDSHSIHWYRKTWTGQSPLRIAAARISHRLLGKGLS
AKIKKLLHI

Enzyme Prediction     

No EC number prediction in MGYG000000673_01177.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	23	97	6.9e-20	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	7.60e-14	25	98	7	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	1.53e-13	4	143	82	216	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam05704	Caps_synth	6.21e-08	1	97	43	144	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK64207.1	9.80e-83	4	247	2	245
QCD38546.1	1.52e-82	3	247	2	242
QCP72238.1	1.52e-82	3	247	2	242
QIU95148.1	2.02e-77	4	247	2	241
QIA43512.1	5.80e-74	1	227	2	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000673_01177.