CAZyme Information: MGYG000000675_00110

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00110
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
745	MGYG000000675_1|CGC5	80838.44	4.8159

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 152215; End: 154452 Strand: +

Full Sequence      

MNTLKKATVYGLTVFSLLACKPGQDSTEQKIDALLSKMTLKEKIGQMNQLTGLGLAEDMQ
DAIRNGEIGSILNELDLATTNKLQHIAVEESRLGIPLIFARDVIHGFKTIFPIPLGQAAS
WNPQVAENGARVAALEASSVGIRWTFAPMIDISRDPRWGRIAESCGEDPYLTTVMGNAMI
KGFQGDTLSSPTSIAACAKHFAAYGASESGKDYNTTWIPELQLRELYLPPFKAAVDAGAA
TFMCSFNDINGVPSSGSTFLNRQILRDEWKYDGLLVSDWGSIQQMIPHGFCADLKEAGEK
AAIAGVDMDMMSYAYINHLEELIKEKKVDEKLIDESVRNILRLKFRLGLFDNPYIKEGAP
SAFYLDSSLQQAKEAAIESAVLLKNNLQTLPLNSSIKSVAVVGPLADAPADQIGTWCFDA
EPEHCVTPLTAIQQECENKIRVIAEPGLTYSRDKSEAGIAKAVAAACQADVILFFAGEEA
VLSGEARCRADISLPGKQTEMLRALKATGKPVVLVIMAGRPLTIPEEVDMADAVLYTFHG
GTMAGPAISDLLFGKAVPSGKLPVTLPRMVGQVPIYYAHKNTGRPASNITLIDDIEVGAK
QTSIGFTSYHLDAGDGPLFPFGYGLSYTTFTYGDCQLSAGNIKQGDVLTVACDVTNNGSY
DAQEVVQLYIRDKVGSLVRPVKELKGFKKVMIKAGETQKVEFTLTTDDLAYWNDDMQRRT
EIGDFTVWIATDSQSGVGADFKLIN

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	89	311	5.3e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	12	743	4	764	beta-glucosidase BglX.
COG1472	BglX	6.17e-110	38	437	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.79e-88	39	343	1	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.54e-69	20	729	32	768	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.64e-52	380	627	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93825.1	0.0	1	745	1	745
QIU94703.1	0.0	6	741	4	738
AFH08277.1	0.0	16	742	18	736
AIA99581.1	0.0	16	742	18	736
QPH56446.1	0.0	1	745	1	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	2.15e-197	18	743	1	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.21e-196	18	743	1	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	1.71e-182	21	735	4	742	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.54e-181	28	744	4	733	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	8.33e-181	22	744	30	765	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.23e-192	34	744	41	765	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	5.02e-191	31	744	38	765	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	7.66e-123	28	743	37	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
T2KMH0	3.55e-117	23	745	29	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	9.65e-116	22	727	30	759	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000029	0.010699	0.989296	0.000005	0.000008	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00110.