CAZyme Information: MGYG000000675_00181

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00181
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000000675_2|CGC2	36059.51	8.5357

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 89361; End: 90323 Strand: +

Full Sequence      

MLMPRKILFSLFLLIGVSLYAQQSSFVSSYVRGNFYNRGRISTESLRASDDLIFLNVHPN
KDGALSFENPRVFQGEGVTTWEGLVKSVRAKVKGTNAKLRLGASSGEWKAMVADEAARTV
FAKNIKKVLQQHKLDGIDLDFEWAENAKEYEDYSLAILKMREVLGDKYIFSVSLHPVCYK
ISKEAIAAVDFISLQCYGPSPVRFPIEKYCSDIQMVLDYGIPKEKLVAGVPFYGVTKDNS
KKTETYFSFVQEGLITSPAQNEVTYKGDVYVFDGQDNIRIKTRYAKEQGLKGMMSWDLAT
DLPLSDSRSLLKAMIEELKP

Enzyme Prediction     

No EC number prediction in MGYG000000675_00181.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	62	303	9.9e-38	0.7905405405405406

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	1.29e-30	54	301	30	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	4.22e-29	91	301	77	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	7.59e-28	52	301	29	334	Glyco_18 domain.
cd02872	GH18_chitolectin_chitotriosidase	2.81e-19	93	301	65	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
cd02879	GH18_plant_chitinase_class_V	9.83e-17	102	301	77	293	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM99667.1	1.73e-204	1	319	1	319
QGT72505.1	2.46e-204	1	319	1	319
QUR45508.1	3.49e-204	1	319	1	319
QUT31567.1	3.49e-204	1	319	1	319
CBK67208.1	2.66e-203	3	319	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	2.00e-18	65	301	44	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
4MNJ_A	1.40e-10	113	302	91	334	CrystalStructure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
6TSB_AAA	1.50e-10	27	301	38	337	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	1.60e-10	27	301	57	356	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
4MNL_A	3.38e-10	113	302	91	334	CrystalStructure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta],4MNM_A Crystal Structure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	5.45e-09	91	301	147	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
Q9W092	1.44e-08	105	301	131	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
E9QRF2	1.78e-08	92	307	121	395	Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiB1 PE=3 SV=1
Q873X9	1.78e-08	92	307	121	395	Endochitinase B1 OS=Neosartorya fumigata OX=746128 GN=chiB1 PE=1 SV=1
C5P230	4.19e-08	92	301	115	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000501	0.998697	0.000260	0.000167	0.000168	0.000163

TMHMM  Annotations     

start	end
7	26