CAZyme Information: MGYG000000675_00298

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00298
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	MGYG000000675_3|CGC3	54728.14	7.1048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 92261; End: 93757 Strand: -

Full Sequence      

MKKNIIAICSFVLAFPLLGQAMQPTVSGEKTTKEYPVPDRSKVAAFPGADGAGKYTTGGA
GGAVYTVTSLADDGSEGTFRWAVSKKGPRTIVFAISGIIELQKALKLNNGDVTIAGQTAP
GDGICLKNYTFSIQADNVIVRFIRSRMGVDIKQKGDDAMNGTKAHKNIIIDHCSMSWCTD
ECATFYDNSNFTLQWCLISESLANSIHEKGAHGYGGIWGGQPASFHHNLLAHHTNRTPRL
CGSRYTGKPENEKVELFNNVIYNYGSDGAYAGEGGSYNFINNYYKPGPFSTTKGSFKRLF
TAYADDGKNNNEAGVHGVFYFNGNYMDPTCPKLTDKQREALYKVNRDNSYGLVIKKDFAT
EKEVLSGKAFDIAEHTSLQPAKKAYKDVLQFAGASYRRDAVDQRIVEETRKGTYTYEGSH
GSTNGMIDQPSDVGGWPEYKSEPALTDSDGDGIPDEWEKKHNLNPNDPSDGAKYTLSPEY
TNLEMYMNSLVNHLYPKK

Enzyme Prediction     

No EC number prediction in MGYG000000675_00298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	96	284	6.4e-78	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	1.54e-08	56	294	48	287	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	8.44e-07	98	276	3	175	Amb_all domain.
pfam18884	TSP3_bac	1.51e-04	447	468	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM11671.1	0.0	1	498	1	498
QUT78078.1	0.0	1	498	1	498
QRQ55765.1	0.0	1	498	1	498
SCV08373.1	0.0	1	498	1	498
ALJ48955.1	0.0	1	498	1	498

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	1.80e-47	43	495	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	4.84e-47	43	495	21	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	6.59e-47	41	495	18	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	4.75e-46	41	495	18	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
A1DPF0	6.74e-46	43	495	21	419	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000402	0.998668	0.000251	0.000236	0.000229	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00298.