CAZyme Information: MGYG000000675_00374

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00374
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000675_4|CGC3	44315.42	6.8196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 69940; End: 71082 Strand: -

Full Sequence      

MKKSLLSFFTVTLLFCLMPVHPVAAQELPAQEETLKTIIKVNDYFMKKYADYTIPSFYGR
VRPSNIWTRGVYYEGLMSLYGIYPREDYYRYAYDWADFHKWGMRNGNTTRNADDHCCGQT
YIDLYNICPSDPNMIRNIKASIDMVVNTPQVNDWWWIDAVQMAMPIFAKFGKMTGEQKYY
DKMWDMYYYTRSQHDKTGMFNQKDGLWWRDQDFNPPYKEPNGEDCYWSRGNGWVYAALVR
VLDEIPADEKHRQDYINDFLTMSKALKKCQREDGFWNVSLHDPTNFGGKETSGTALFAYG
MVWGVRNGLLDRKEYLPVALKAWNAMVKDAVHPNGFLGYVQGTGKEPKDGQPVTYKSVPD
FEDYGVGCFLLAGTEIYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	378	3.4e-94	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.98e-118	37	380	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.82e-53	45	379	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94559.1	1.66e-296	1	380	1	380
ALJ49013.1	6.42e-285	1	380	1	380
QRQ55821.1	6.42e-285	1	380	1	380
SCV08431.1	6.42e-285	1	380	1	380
QNL41144.1	2.62e-284	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	4.49e-71	1	375	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.43e-66	32	375	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.69e-49	61	380	48	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
4WU0_A	1.16e-13	137	379	101	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	3.73e-52	67	380	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.73e-48	61	380	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.55e-36	111	376	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000212	0.999115	0.000203	0.000163	0.000149	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00374.