CAZyme Information: MGYG000000675_00376

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00376
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000000675_4|CGC3	53040.31	6.6339

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 73197; End: 74606 Strand: +

Full Sequence      

MNIRIIAVASLLIALPVSAQKKKPVVNDSNTPLHLLQPAYQGTYGDLTPEQVKKDVDRVF
TYIDKETPARVVDKNTGKQITDYTTMGEEAQLERGAFRLASYEWGVTYSALIAATEATGD
QRYTDYVQSRFRFLAEVAPHFKRVYEEKGTTDPQLLQILTPHALDDAGAVCAAMVKLRLK
DSSLPVDELIRNYFDFIINKEYRLADGTFARNRPQHNTLWLDDMFMGIPAVAQMSCYDKA
KKEKYLAEAVRQFLQFADRMFIPEKGLYRHGWVESSTDHPAFCWARANGWAMLTACELLD
VLPENYPQRSKVMDYFRAHVRGVTALQSGEGLWHQLLDRNDSYLETSASAIYVYCLAHAI
NKGWIDAIAYGPVAHLGWHAVSGKINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAHGY
GPVLWAGAEMIRLLKNQYPQMNDSAVQYYQKKQKTTAPIFAVETEERND

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	96	432	9.5e-92	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.20e-107	62	434	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.11e-48	102	434	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94561.1	0.0	1	466	1	466
QQR18601.1	0.0	1	469	1	469
ANU56551.1	0.0	1	469	1	469
CBK68243.1	0.0	1	469	1	469
QDH54531.1	0.0	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	1.45e-301	22	465	2	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.01e-21	216	413	163	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	1.89e-20	102	436	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.63e-20	102	436	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	7.46e-19	216	413	164	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.04e-19	102	436	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	4.12e-17	50	431	37	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	7.43e-17	101	438	28	343	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	1.16e-12	226	435	1	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.16e-12	226	435	1	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000453	0.997433	0.001529	0.000183	0.000191	0.000173

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00376.