CAZyme Information: MGYG000000675_00626

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_00626
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1232		140613.76	6.6903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 37039; End: 40737 Strand: -

Full Sequence      

MNRISKVFLACACSAFCMNGQAQDNASWTNDFSNAGETLKVVGRGTCSIADNVFRSKGSY
ALFGNPEWKNYSFSFKARAPKNAEQVQIWASFRNYNRFDRYVVGIKGGLQDDLYLMRTGY
MGTDEFMGVRPLGFHPVPGEWYQVKVEVCGNRIRIFLNDEKQPRIDLVDKNANLVPSGEV
ALGGGWIETEFDDLVVTPMADDALKDVKVAEYKKKATPAEKENKRRQERAAYTPVQLKAL
TGSRTDITLDGNWLFMPDYQLDNKDKAISTQTDDKDWHIMSVPNFWNPIRIWLHGETMPS
PTGAQPKGVSDTYYQQETDRCENYTFDYRRVKYAWYRQWLELPADVSGKNLTLTFDAVSK
IAEIYINGTLAASNIGMFGEIRVDGSQLLKPGKNLLTVKVTRNADGSTSSDSNSIDFFYS
SVRESEKEDGKVTVKKDILKDIAHGFYGDEPAGIWQPVKLTVTDPMKVEDVFIKPTLQGA
TFDVTVKNHGNKKKQFDLYTDIIDKETGSMLYSGLSLRKLNLNAGEERMETYTINDLKPR
LWTPQHPNLYDFKFRLVADKGTELDCLTETSGFRTFEVKDGLFYLNGSKYWLRGGNHIPF
ALAPNDENLANTFMQLMKAGNIDVTRTHTTPWNKLWMAAADNNGIGVSFEGTWSWLMIHS
TPIPDQRLLEMWRDEFLGLLKKYRNHPSLLFWTVNNEMKFYDNDSDLKRAKEKYRIISDV
VKEMRRIDPTRPICFDSNYQAKGKDKKFGADFMNSIDDGDIDDMHGYYNWYDYSVFRFFN
GEFQKQFKVADRPLISQEMSTGYPNNETGHPTRSYQLIHQNPYTLIGYEAYDWADPASFL
KVQAFITGELAETLRRSNDQASGIMHFALMTWFRQTYDYQNIEPYPTYYALKRALQPVLV
SAELWGRNLYAGEKLPTRIYIVNDREDGTDLKPSLLRWEIQDETGKRLANGCENIPAVKH
YARYYIEPNIQLPTCLPAGKTKAKLVLKLTENGLPISANEYELLLARKEWNAGQVDNSKK
IVLLDKDNTKDVFDFLNIKYQPVSSVKELLNSKLKADLCVISGLTACTDEEKEMLRAYQS
KGGKLLFLNSKEAVKTVYPEYITGWIIPTEGDIVIMERNDAPVFNDIDVLELRYFNNNKR
EIPVVCTATLKAHRHKNVTELAGQMKIHAYIDGGKPEDRIERIESMRGLTMLQIADGKGE
AMISTMCTEKAATDPIAGKLVVNMINCMTTNK

Enzyme Prediction     

No EC number prediction in MGYG000000675_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	233	993	7.3e-84	0.7367021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.95e-29	240	771	6	476	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.66e-29	335	777	66	486	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.28e-22	249	745	44	484	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	9.27e-13	468	574	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02836	Glyco_hydro_2_C	5.09e-12	576	798	1	209	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU96993.1	0.0	1	1232	1	1232
QGT71556.1	0.0	1	1232	1	1233
QDO68995.1	0.0	1	1226	1	1225
ALJ60854.1	0.0	1	1226	1	1225
QUT88128.1	0.0	1	1226	1	1225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.21e-24	247	697	40	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.21e-24	247	697	39	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ED1_A	3.21e-20	245	771	25	485	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
3GM8_A	1.15e-19	267	733	24	421	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
7KGY_A	1.75e-19	243	864	14	579	ChainA, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_B Chain B, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_C Chain C, Beta-glucuronidase [Faecalibacterium prausnitzii],7KGY_D Chain D, Beta-glucuronidase [Faecalibacterium prausnitzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.61e-24	247	697	40	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	2.53e-23	238	741	45	474	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
O52847	3.91e-20	248	697	60	481	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q04F24	2.32e-18	244	707	45	467	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
B4S2K9	6.93e-18	344	697	133	460	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000680	0.799116	0.199250	0.000360	0.000323	0.000265

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_00626.