CAZyme Information: MGYG000000675_01014

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_01014
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	MGYG000000675_14|CGC1	83350.81	5.1555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 66268; End: 68415 Strand: -

Full Sequence      

MIISRYFGNPKLGRNLGNQLFELAALIGLAKRYNTTLLLPSLWQYRSSFNLGSSIEYGDV
EAFVSIREPAFHCCLEFFDKFENIIKDERVYIEGYFQSELYWKPFEDEIRKAFDFTTSIE
KDTDLFLIENNVDVEKMVAVSVRRGDFVTDPNHYLLPLEYYVGALSRFFPEKDIMVFSDD
ITWCKEHFNLADRRVVFSENKSAIEQLSLMSRFSNFVLANSTFSWWGAYLSKAENKKVIC
PYYHFDGELKIKNSLKDHYPSSWIIYNHYNINMNHPVYIVNLPQRTDRREHILAQFLDRP
EFIVHIKEPVVHTIGAVSLWLTLRNIVKEEKEKGSPYFILCEDDHTFTNAYSTELLEKCI
LRANSLQADVLSGGVSWFSSAMRTDDTLFWIEQFTGMQFTVIYNRFYERLLESPYDDCVV
TDFQISKMTLKKWMIYPYISVQTEFGYSDVTKQNNDAGFVGKIFHTAMNRFDVLDRVVAH
YQLANLGKNEYELSDLPSDIAIPTYVINMKERPERLKHVLSQFEGKTEFDIHVVEAYKHE
IGAVGLWQSIVKIIKEIVNGDDDVIIICEDDHTFTLDYCREEFMHHVIKAAEQGVEVLSG
GIGGFGSACPIGTKRYWIDWLWCTQFIVVYRPFFQRILDEPFTDTDTADGKISEMTSNKA
VIYPFISIQHDFGYSDVTRGNNESKGKITEYFRETDKRFGIISGMLRYHNEVLDI

Enzyme Prediction     

No EC number prediction in MGYG000000675_01014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	15	264	3.7e-55	0.9601449275362319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	3.85e-41	1	244	1	254	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.66e-22	16	264	41	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
COG3306	COG3306	8.47e-07	501	575	2	100	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
cd06532	Glyco_transf_25	1.07e-06	503	571	1	92	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
cd06532	Glyco_transf_25	0.002	276	344	1	92	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDN30683.1	1.07e-80	92	705	364	991
QUB60703.1	7.79e-77	495	711	370	586
QUB69923.1	7.94e-76	495	711	370	586
ATR96316.1	1.43e-75	502	710	382	590
QUB82181.1	4.17e-75	495	711	370	586

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	5.57e-16	94	264	124	300	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
P91200	8.58e-09	16	263	74	341	Galactoside 2-alpha-L-fucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=fut-2 PE=1 SV=1
Q966A0	1.48e-06	16	263	76	348	Putative galactoside 2-alpha-L-fucosyltransferase svh-11 OS=Caenorhabditis elegans OX=6239 GN=svh-11 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000015	0.000016	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_01014.