CAZyme Information: MGYG000000675_01814

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_01814
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000675_32|CGC1	47473.31	6.2365

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 33803; End: 35032 Strand: +

Full Sequence      

MLGLCIGIGSSCTPKLGNTIVEDNMMFAQLQLRVAFDEIDYARTNESPESREKREKNGWG
ELTNPRNSEPDGSLHLVPSKDWTSGFFPGELWYIYEYTQNNFWKKKAQQHTDMLEQEKMN
GKTHDMGFKMYCSYGNGYRLTQDERYKEILLQSARTLATRYKPAAGIIRSWDHNKNKWQC
PVIIDNMMNLELLFWATRESGDSTYYNIAVNHARTTLKNHFRPDYSCYHVIDYDTITGNV
LKKNTHQGLSHESAWSRGQAWALYGYTMCYRETKLPEFLQQAQKVEEYLFNHPHMPADLV
PYWDFDAPNIPNEPRDASSASVIASALYELSLYDTENAEKYQQQADRIIENLAKNYRSDM
GQNNGFLLLHSTGTKPSNTEVDVPIVYADYYFIEALMRKDKLEKTGKLF

Enzyme Prediction     

No EC number prediction in MGYG000000675_01814.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	79	398	1.1e-134	0.9787234042553191

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.70e-13	81	292	28	225	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26295.1	8.47e-263	4	409	19	425
QNL40019.1	4.14e-254	4	409	10	416
ALJ44845.1	3.73e-216	1	409	11	419
SCV09180.1	3.73e-216	1	409	11	419
QRQ56516.1	3.73e-216	1	409	11	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	4.77e-116	64	404	55	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	3.64e-50	76	398	62	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.72e-50	76	398	63	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.02e-49	76	398	63	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.99e-49	76	398	63	389	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	5.24e-125	74	402	69	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	4.58e-52	71	398	56	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	1.02e-50	65	398	53	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	2.04e-49	76	398	63	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	2.09e-45	65	401	25	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_01814.