CAZyme Information: MGYG000000675_03027

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_03027
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000000675_83|CGC1	51926.86	4.3546

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 13357; End: 14748 Strand: +

Full Sequence      

MKNDILSLSKKTLLLGGAFVMFAACDNGDLGDIYKGDSSGEYVSDVNWTDAANLSTGTYI
KYFFENAGGRDTFCGSIYWEKPNTPQTGEPVSTGGSGGWSQGHALDIVIDAYVRSANDPQ
YQAYLYENIMKPFLPAFDDWNEHCGYGGKDFWNNFYDDMEWMALACLRVYELTGDEDYYS
ALMKMWDHIKGAKNDYKGAGGMAWKTDSPASRMACSNGPGCLLAMKLYKLTVVEAKDGWE
DKAAYYLNFAKEVYNWMTAYLCDTSTGQVYDNLGIRDDGTPGDPDKVALSYNQGTFMASA
LELYNATGEEEYLRNAVAFAAYQVNKKMDSNYPVFSGEGNSGDNLLFRGIFVRYFLDMLK
QPVSSVYPEKTKNKFIAALRSCSDVLWALAHPDGYYVWEYSWSKAPEFGNRDNREDRLTI
SLNAEVPGATLIEIRARYEDWVQGKATEEPNWIGPDFGKSTEE

Enzyme Prediction     

No EC number prediction in MGYG000000675_03027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	52	405	6.1e-72	0.9078212290502793

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	2.48e-26	48	407	3	328	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	5.27e-25	99	355	36	288	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94027.1	0.0	1	463	1	463
QRQ55352.1	0.0	1	463	1	463
SCV07928.1	0.0	1	463	1	463
QUT32576.1	0.0	1	463	1	463
QDM11364.1	0.0	1	463	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	4.58e-43	99	439	89	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.25e-41	99	439	90	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	8.93e-41	99	439	90	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	7.19e-31	48	439	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	5.48e-26	99	369	39	287	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000003	0.000021	1.000027	0.000001	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_03027.