CAZyme Information: MGYG000000675_03274

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_03274
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42814.28	7.0323

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 16942; End: 18054 Strand: -

Full Sequence      

MKKTLLLGVSLLCSVFIMATEVPFQKAEIKSIMRKVADWQIANPHPAPEHDDLNWPQGAL
YVGMVDWAELAEKEDGDDTYYKWLTRIGRRNCWQPDKRFYHADDIAVSQSFLDLYRKYKD
EAMIIPTLARTEWIVNHPSEGSFKLVEGDLKTLERWTWCDALFMAPPVYAKLYMLTGEKK
YIKFMNREYKATYDYLFDKEENLFYRDWRYFDKREANGKKVFWGRGNGWVLGGLVEILKE
LPKKDENRKFYAELFVKLATRVAGLQHPDGFWHASLLDPASYPSPETSCTTFIVYSIAYG
INEGLLDKETYLPVMVKGWNALVSAVEPNGKLGYVQQIGADPKKVTRDMTEVYGVGAFLM
AGNEIYKMAR

Enzyme Prediction     

No EC number prediction in MGYG000000675_03274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	367	3.1e-90	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	9.00e-103	32	368	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	8.27e-54	51	369	32	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH53356.1	4.66e-282	1	370	1	370
QUT26116.1	4.66e-282	1	370	1	370
QRM99764.1	6.62e-282	1	370	1	370
QUT31467.1	1.34e-281	1	370	1	370
QUR45649.1	1.90e-281	1	370	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.26e-78	24	368	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	3.04e-57	27	364	31	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.21e-48	65	364	65	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	5.96e-15	48	370	34	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.47e-14	48	370	24	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	5.39e-78	27	368	32	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	7.61e-78	1	368	1	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	6.41e-73	23	365	49	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	3.26e-14	48	370	34	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000760	0.998299	0.000284	0.000217	0.000215	0.000205

TMHMM  Annotations     

start	end
5	24