CAZyme Information: MGYG000000675_03522

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_03522
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314	MGYG000000675_115|CGC1	36774.97	8.9852

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 2826; End: 3770 Strand: -

Full Sequence      

MDSYIYILDDLVFFFTGVLFLYLFILAVASHFKHIIYSKTKKKYHCAILIPEGSPLITIY
KEEPYEFITYNDLYQRINSLDKEQYDLVLILSDTACALSPRLLDKIYDAYDSGIQAIQLH
SITENRQGFRNRFRILCDEIKNSICRAGNTQFGLSSNLLGTNMAIDLEWLQKNLKSSKTN
IERKLLRQNIYIDYLPDAIVYCQSSPVCPYRKRIRKMASYLLPSLLEGNWSFFNRIIQQL
IPSPLKLCIFVGIWALLITGYDWTSSFSWWILLFGLLITYSLAIPDYLVEDKKKKKHSIW
RKRHLNSELKEIPA

Enzyme Prediction     

No EC number prediction in MGYG000000675_03522.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13632	Glyco_trans_2_3	7.83e-11	87	282	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
pfam13641	Glyco_tranf_2_3	0.004	85	204	88	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06438	EpsO_like	0.008	82	173	79	170	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU96407.1	1.08e-220	1	314	1	314
QUT24338.1	1.25e-185	1	314	2	315
QDH56310.1	1.46e-184	1	314	2	315
QDM07248.1	1.46e-184	1	314	2	315
QUT81293.1	1.46e-184	1	314	2	315

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
240	257
267	289