CAZyme Information: MGYG000000675_04371

Basic Information

• Species: Bacteroides congonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides congonensis
• CAZyme ID: MGYG000000675_04371
• CAZy Family: CE7
• CAZyme Description: Acetyl esterase Axe7A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
157		17556.11	8.8615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000675	5782172	MAG	Kazakhstan	Asia

• Gene Location: Start: 7; End: 480 Strand: +

Full Sequence      

MRAIDFIYTLPEFNGNLATFGGSQGGALSIVIAGLDARVKGLVAFYPALCDMAGYAHGRA
GGWPHMLKDEKNRTPEKMKTLQYFDVVNFARQVKVPGFYTFGYNDMVCPPTTTYSAYNVI
NAPKELFVAETTAHYAYAEQWSAAWNWVMNFLKNKSK

Enzyme Prediction     

No EC number prediction in MGYG000000675_04371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE7	1	148	2e-45	0.48881789137380194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3458	Axe1	7.06e-26	2	137	162	302	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
pfam05448	AXE1	3.73e-23	2	134	160	299	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.
COG1506	DAP2	0.007	16	157	474	618	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK67089.1	3.36e-108	1	157	276	432
QRM99767.1	3.36e-108	1	157	276	432
QDH53354.1	4.77e-108	1	157	276	432
QUT79463.1	6.76e-108	1	157	276	432
QDM10171.1	6.76e-108	1	157	276	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6AGQ_A	6.67e-19	1	134	162	303	Acetylxylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_B Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_C Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_D Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_E Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4],6AGQ_F Acetyl xylan esterase from Paenibacillus sp. R4 [Paenibacillus sp. R4]
5GMA_A	1.03e-17	1	134	177	315	Crystalstructure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8],5GMA_B Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8],5GMA_C Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8],5GMA_D Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8],5GMA_E Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8],5GMA_F Crystal structure of the P228A variant of Thermotoga maritima acetyl esterase [Thermotoga maritima MSB8]
1VLQ_A	1.42e-17	1	134	177	315	Crystalstructure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_B Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_C Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_D Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_E Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_F Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_G Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_H Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_I Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_J Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_K Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8],1VLQ_L Crystal structure of Acetyl xylan esterase (TM0077) from Thermotoga maritima at 2.10 A resolution [Thermotoga maritima MSB8]
5HFN_A	1.57e-17	1	134	151	289	Crystalstructure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8],5HFN_B Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8],5HFN_C Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8],5HFN_D Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8],5HFN_E Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8],5HFN_F Crystal structure of a loop truncation variant of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 2.75 Angstrom resolution [Thermotoga maritima MSB8]
3M81_A	1.97e-17	1	134	177	315	Crystalstructure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],3M81_B Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],3M81_C Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],3M81_D Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],3M81_E Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],3M81_F Crystal structure of Acetyl xylan esterase (TM0077) from THERMOTOGA MARITIMA at 2.50 A resolution (native apo structure) [Thermotoga maritima],5FDF_A Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5FDF_B Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5FDF_C Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5FDF_D Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5FDF_E Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5FDF_F Crystal structure of the monoclinic form of Thermotoga maritima Acetyl Esterase TM0077 (apo structure) at 1.76 Angstrom resolution [Thermotoga maritima],5JIB_A Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8],5JIB_B Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8],5JIB_C Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8],5JIB_D Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8],5JIB_E Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8],5JIB_F Crystal structure of the Thermotoga maritima acetyl esterase (TM0077) complex with a substrate analog [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EXI2	2.52e-43	1	139	286	425	Acetyl esterase Axe7A OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe7A PE=1 SV=1
Q9WXT2	9.77e-17	1	134	165	303	Cephalosporin-C deacetylase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=axeA PE=1 SV=1
P94388	1.60e-14	1	134	158	298	Cephalosporin-C deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=cah PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000675_04371.