CAZyme Information: MGYG000000676_01623

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000000676_01623
• CAZy Family: GH151
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
643	MGYG000000676_66|CGC1	71969.32	5.3205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000676	2188584	MAG	Kazakhstan	Asia

• Gene Location: Start: 1290; End: 3221 Strand: -

Full Sequence      

MKRRKDCFFGLHFDFHATRETKGIGAFFDAEKLEEILQRVRPDFVQCDTKGHPGISSYPT
KVGNPAPDMRGDILRQWRDITEKYGVGLYAHYSGVWDTEAIAKHPDWAAVKADGTPSADI
TSVFGPYVDELLIPQLKELALDYGLNGAWIDGDCWATIPDYGPRAAAEYQKKYGRLPEKP
DEEGHGRFNAFCREQFYRYAEHYIKAVKAAAPDFEITSNWLNTAQAPDEFVCTDYISGDL
ESEDSAYSARFNGRLIADYGRPWDIMAWGFRLSNGIFYMKTPAQLCQEAAAILSVGGGVQ
IYEIQHPNHVMKEGWAVDDLAAVAQFCRDRQPYCQYAKSIHDVGVIHSNAAFYHINDQWF
GWGGEYTQDTRGILNALLDSQASAEIVLTHSALRRDLSEYSALFVGNIGVIEDELKEKLL
AYAAQGGQLFLLGANTAELFAADTGISIQKKVTSDPVLRVKGGEMRAEVHQAYAVLSAQN
IVSEMQTLESVDKLLYPAEDIPACVATLYGRGEIVTVPFNFGLAYWRENTAALGEFAAEL
VRRIRGRKLTAESSRYVTVNLMQKEDAEYIHLLNMAGPHRSVSVKTFAEIPPLHDIKVSY
RRAEKPVSAVMYPEGKPLAFTYKNGTVNMQVEELDIHSVIEIR

Enzyme Prediction     

No EC number prediction in MGYG000000676_01623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH151	29	151	5.7e-21	0.9847328244274809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14871	GHL6	5.62e-08	29	151	1	134	Hypothetical glycosyl hydrolase 6. GHL6 is a family of hypothetical glycoside hydrolases.
cd03143	A4_beta-galactosidase_middle_domain	3.69e-05	343	473	1	123	A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. A4 beta-galactosidase middle domain: a type 1 glutamine amidotransferase (GATase1)-like domain. This group includes proteins similar to beta-galactosidase from Thermus thermophilus. Beta-Galactosidase hydrolyzes the beta-1,4-D-galactosidic linkage of lactose, as well as those of related chromogens, o-nitrophenyl-beta-D-galactopyranoside (ONP-Gal) and 5-bromo-4-chloro-3-indolyl-beta-D-galactoside (X-gal). This A4 beta-galactosidase middle domain lacks the catalytic triad of typical GATase1 domains. The reactive Cys residue found in the sharp turn between a beta strand and an alpha helix termed the nucleophile elbow in typical GATase1 domains is not conserved in this group.
smart00812	Alpha_L_fucos	0.001	27	204	80	253	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam01120	Alpha_L_fucos	0.002	27	204	83	253	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXE19470.1	1.72e-149	3	643	23	661
QGQ97761.1	1.09e-142	3	642	2	641
AYQ34964.1	2.65e-142	3	643	23	661
QEC53053.1	4.18e-137	3	642	28	669
QMW03230.1	1.52e-124	8	642	32	673

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000676_01623.