CAZyme Information: MGYG000000677_00361

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000000677_00361
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
298	MGYG000000677_11|CGC1	33520.99	5.586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000677	2015211	MAG	Kazakhstan	Asia

• Gene Location: Start: 9008; End: 9904 Strand: -

Full Sequence      

MLRLTVGKSGNEDYYYISEALNAVPYNEKAEIYIKEGIYREKLFSDKKNLRLIGEGNVLI
TYSDFGREKVELGKKRGTFRSYTAFFSGEKLYMENITIENSAGDGSRVGQAIALYLDAAD
AYLKNVKLIGAQDTLFISPLPESEREIGGFYGPRAFNPRKLTRNIFENCYVEGNIDFIFG
SGNALFKDSLIAIKGKGYITAPSTGKDDIGFVFYNSTLKSIDGGDETFIMRPWRQFGKIT
LISSRIEGVFNKALWTHWPGREAEKSDALCALYAVERSGDDIIKLSEEEANRILSYFS

Enzyme Prediction     

No EC number prediction in MGYG000000677_00361.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	279	4.5e-61	0.8958333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.30e-41	13	296	93	396	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	5.13e-35	4	266	7	257	pectinesterase
pfam01095	Pectinesterase	6.78e-35	5	266	3	253	Pectinesterase.
PLN02990	PLN02990	5.87e-28	6	276	263	518	Probable pectinesterase/pectinesterase inhibitor
PLN02708	PLN02708	3.88e-27	5	266	244	504	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY12911.1	5.35e-90	1	262	1	264
ADL33824.1	6.97e-72	8	273	12	297
CBK98674.1	3.82e-68	1	246	1	252
AXA81880.1	3.04e-67	1	246	1	252
QIA44050.1	4.99e-65	1	261	1	267

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	4.44e-22	6	266	7	256	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	8.20e-21	4	263	9	257	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	1.11e-19	4	256	11	246	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.48e-19	4	256	11	246	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	1.10e-17	32	218	37	227	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	3.83e-27	6	266	9	257	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	1.63e-23	6	266	260	510	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
O49298	9.81e-23	4	273	251	497	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q4PT34	1.15e-22	4	256	46	287	Probable pectinesterase 56 OS=Arabidopsis thaliana OX=3702 GN=PME56 PE=2 SV=1
Q8L7Q7	1.47e-22	4	266	289	553	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000677_00361.