CAZyme Information: MGYG000000677_01130

Basic Information

• Lineage: Bacteria; Spirochaetota; Spirochaetia; Sphaerochaetales; Sphaerochaetaceae; UBA5920
• CAZyme ID: MGYG000000677_01130
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000000677_69|CGC1	41617.14	5.3139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000677	2015211	MAG	Kazakhstan	Asia

• Gene Location: Start: 4923; End: 6008 Strand: +

Full Sequence      

METKKPLSILMAKSVEKRYQPGMMKWHYEHGLVLFASLKAAELHSDPTIYPWVYSMYDRL
IEKDGTIDTYREGEFNLDQINAGRALFTLEDKSGEERFRLAEDRLKSQLVKQPRCKCGVY
WHKEIYPWQIWLDGLYMEGPFNAEYAVRHNDDKSLDDVINQLEITYNTLKDPKTGLLYHA
YDESRGQRWSDINTGLSPHFWSRSIGWYLMAVIDVLDFTPENHPKRDVLVSIVKNLSSAV
LPFQDESGMWYQVPDLKDREGNYLETSGTSMFAYSFLKGVRLGYLDESFSSYGLKAIEGI
KKLYLTEENGEYHLGGICSVAGLGGNPYRDGSFKYYIQEKIATDDFKGVGPFILALTEAE
R

Enzyme Prediction     

No EC number prediction in MGYG000000677_01130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	22	361	1.6e-107	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	3.00e-97	10	361	18	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.13e-94	25	361	26	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV29772.1	7.76e-156	1	361	1	367
ADY14808.1	1.36e-155	7	361	8	364
AEC01301.1	3.15e-148	2	361	4	366
QQO10808.1	1.96e-128	5	360	8	372
QZK90134.1	4.84e-121	11	361	37	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	9.59e-109	8	360	5	359	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	5.81e-77	21	360	34	365	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.44e-76	21	360	24	355	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.43e-12	130	361	199	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4Q88_A	3.68e-08	120	286	138	292	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.18e-76	21	360	34	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	9.66e-41	140	359	4	228	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	9.66e-41	140	359	4	228	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.20e-15	26	310	29	294	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	9.65e-07	131	287	201	351	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000677_01130.