CAZyme Information: MGYG000000678_00792

Basic Information

• Species: CAG-485 sp002491165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002491165
• CAZyme ID: MGYG000000678_00792
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MGYG000000678_10|CGC2	26310.44	9.6338

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000678	2629642	MAG	Kazakhstan	Asia

• Gene Location: Start: 50284; End: 50982 Strand: -

Full Sequence      

MIKRIFKLIGILILIFLVSSLAGVVYYKMAPVQVTPLMLIRSVSPKGTPAQVEQEKHWEH
RWVPYSEITPLMERAVRSSEDGRFYSHNGFDTIEIRHAMEEAERGGKLRGASTVSQQTAK
NVFLWPGGGWFRKGLEAWFTVLIETVWGKERIMEVYLNSIETGPGIYGVQAAAEHFFHTD
AEHLTAEQCALIVAALPNPIERDVGNPSPYLKRRAARIRKYMKQQAPPPSTY

Enzyme Prediction     

No EC number prediction in MGYG000000678_00792.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	58	222	2.8e-49	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.03e-100	18	224	21	225	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	4.41e-81	20	224	18	220	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	2.61e-62	60	223	13	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	3.32e-60	20	225	31	243	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.04e-28	63	214	70	223	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT78472.1	7.81e-79	3	222	4	219
AKA51678.1	7.81e-79	3	222	4	219
QRP90391.1	7.81e-79	3	222	4	219
CAH07656.1	7.81e-79	3	222	4	219
ANQ60363.1	7.81e-79	3	222	4	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2G_A	7.06e-21	59	217	37	195	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
2OQO_A	9.83e-21	62	232	22	194	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	9.83e-21	62	232	22	194	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	1.33e-20	52	199	31	178	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5FGZ_A	4.11e-18	62	225	158	327	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3V815	1.56e-79	3	222	4	219	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7G2	1.56e-79	3	222	4	219	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q8A8H2	5.88e-72	2	222	7	223	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
B8GYX9	2.39e-64	12	220	16	214	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=mtgA PE=3 SV=1
Q9ABA6	2.39e-64	12	220	16	214	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999376	0.000571	0.000048	0.000006	0.000002	0.000030

TMHMM  Annotations     

start	end
5	27