CAZyme Information: MGYG000000678_01538

Basic Information

• Species: CAG-485 sp002491165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002491165
• CAZyme ID: MGYG000000678_01538
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000000678_32|CGC1	40392.95	8.163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000678	2629642	MAG	Kazakhstan	Asia

• Gene Location: Start: 12185; End: 13246 Strand: -

Full Sequence      

MKPVKSILVIRFRQMGDMILATAMINALKETYPEATVDVVLNERIAPLFQHHKSIDNILA
FSDDERHNFLQYLTKVWKVVHAKHYDVIIDMRSTVNTLPFTLFSLGSRYRMGIRKPYTPL
LFNHRVGGCKSDESMLDHNFKLIQPLLPDNGKRTVHSKFTIDITEAEKDEFAKQMAEKGI
DFTRPIMIAGVTAKLPEKTWDKRRMAETLRLFHKEFPDCQIIFNYAPGREEENALEIHRM
LDTDKDILIDIQAKSPRELAAMASLSTFYFGNEGGARHIVQAMGKPSFVICSPMASKKTW
LPEDEKIPTEGISPADIIAADRLPEMDAAARYDAITVERVWQRLLPFCKKLGI

Enzyme Prediction     

No EC number prediction in MGYG000000678_01538.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	303	2.5e-25	0.8488888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	3.29e-35	4	347	1	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	3.54e-35	6	344	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK10422	PRK10422	1.23e-13	2	307	3	303	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	9.69e-06	74	287	2	205	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28725.1	3.14e-103	6	344	2	334
ALJ48104.1	2.32e-101	1	352	1	352
SCV07513.1	2.32e-101	1	352	1	352
QGT72869.1	2.32e-101	1	352	1	352
QRQ54976.1	2.32e-101	1	352	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.53e-07	5	293	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	2.40e-08	13	286	2	271	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	3.20e-07	16	286	5	271	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000678_01538.