CAZyme Information: MGYG000000678_02093

Basic Information

• Species: CAG-485 sp002491165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp002491165
• CAZyme ID: MGYG000000678_02093
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
803		90303.59	5.9614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000678	2629642	MAG	Kazakhstan	Asia

• Gene Location: Start: 925; End: 3336 Strand: +

Full Sequence      

MLRFQCLALAAVVLSATFTASAVRSQRSLKQWDFSRDSLKWDKVIIPHDWAIYGPFDRNN
DLQKVTVEQNGETEATWKTGRTGGLPYVGKGYYKNTFELADTTGLSTDLLFDGAMSHARV
YVNGKKVAYWPYGYNSFYVNLDGVVRPGVNTVEVSLENPPESSRWYPGAGLYRNVHLLQT
DRVHIPVWGTYLTTPQVSKDYATVRLVTEVSGVEKRGKVNLKTEIKDPQGRTVATAQGDF
YAYPGVPFTQNLRVERPDLWSPENPALYTAETTVSRDGRVCDTYSTRFGIRSIEYVAGDG
FYLNGVKTKFRGVNNHHDLGPLGAAVNRSALRHQMEIMKDMGVNAIRTSHNMPAPELVEL
ADEMGFMLMIEPFDDWGFRPKCKNGYGTLFNDWAEKDVVNMVRHFRNSPSVVMWSIGNEV
PSQWWEDGLSELKMLQDIVHREDPTRPVTCGMDQLDAVVNNGFAAALDIPSFNYKTNRYH
EIMDKLPQDFVLGSETASTVSSRGQYFFPVKKGSSMMHPGNQSNSYDVEYCDWSNIPDDD
FVQDDDRANNLGQFVWTGFDYLGEPSPYDTDAWPSHVSVFGIVDLASIPKDRYYLYRSQW
NKDDHTLHILPHWNWEGREGEVTPVFVYTDYPKAELFINGKSQGVREKNDSTNMNRYRLM
WMETVYEPGEVKVVAYDDKGNAVAEKMMRTAGKPDHIVLTPSRKELSADGEDLVYITVQV
ADKDGNIVPTDTRRVKFSAKGAGKFRATANGDPTNLDLFHLPEMPLFAGAATAIVQAGDK
PGTVTFEAKAPGVKGAKITIPVK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	26	720	4.7e-113	0.7194148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.79e-61	40	605	41	541	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	9.78e-43	87	450	63	447	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	2.55e-42	697	799	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	2.96e-27	86	448	102	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	4.08e-22	25	448	51	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD35275.1	0.0	32	803	35	811
QDM10520.1	0.0	9	803	9	819
QUT79099.1	0.0	9	803	9	819
QNL36929.1	0.0	9	803	10	815
QDM12109.1	0.0	9	803	10	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	3.59e-202	35	803	48	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.07e-166	37	800	35	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	8.21e-164	41	800	33	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4CU6_A	5.62e-136	37	800	39	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	1.56e-135	37	800	39	842	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.09e-160	41	800	71	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	2.14e-90	33	753	64	770	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	2.36e-52	26	649	64	678	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	7.89e-44	49	789	11	724	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	2.60e-35	111	746	77	705	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000250	0.999178	0.000141	0.000152	0.000136	0.000123

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000678_02093.