CAZyme Information: MGYG000000680_00556

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402
• CAZyme ID: MGYG000000680_00556
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
212		24014.79	4.7905

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000680	2323759	MAG	Kazakhstan	Asia

• Gene Location: Start: 32; End: 670 Strand: +

Full Sequence      

MGQALALYVDGDRIAFHDCRFLGNQDTLFTAPLPPKEIEPNGFVGPKQSAPRINGRHFYQ
RCYIEGDIDFIFGGATAYFEDCEFFSKYTGQPISSYVTAASTPEGQEYGYVCQNCHFTGN
CPPSSAYLGRPWREYAKVVLLNCQMENHICPEGWNDWGKEFAHDTVFFAEYKSYGPGAAM
QSRPEWCHMLDEREAKHFTKELVLGGDDGWNP

Enzyme Prediction     

No EC number prediction in MGYG000000680_00556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	204	5.7e-67	0.6215277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.47e-53	3	206	212	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.45e-50	2	207	105	298	Pectinesterase.
PLN02432	PLN02432	7.60e-50	2	210	111	291	putative pectinesterase
PLN02773	PLN02773	1.06e-44	2	198	120	290	pectinesterase
PLN02682	PLN02682	6.92e-44	3	199	187	356	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET76962.1	1.06e-121	1	212	110	321
QIX89293.1	2.86e-97	2	212	126	348
QRP39805.1	2.95e-97	1	212	126	349
ASN95501.1	2.95e-97	1	212	126	349
ANU50094.1	5.75e-97	2	212	126	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	7.45e-30	3	206	113	304	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	4.14e-27	3	206	109	301	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.31e-26	3	212	129	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1QJV_A	1.61e-21	3	212	129	339	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]
5C1C_A	3.44e-21	3	183	117	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SIJ9	8.98e-38	2	212	151	334	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9LVQ0	6.51e-37	2	199	120	291	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9ZQA4	6.99e-36	3	208	151	331	Putative pectinesterase 14 OS=Arabidopsis thaliana OX=3702 GN=PME14 PE=2 SV=1
Q9ZQA3	2.71e-35	3	208	200	383	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q8L7Q7	1.48e-33	3	208	397	596	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000680_00556.