CAZyme Information: MGYG000000681_00232

Basic Information

• Species: Lactococcus_A raffinolactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A raffinolactis
• CAZyme ID: MGYG000000681_00232
• CAZy Family: GH8
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41860.68	9.38

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000681	1472277	MAG	Kazakhstan	Asia

• Gene Location: Start: 3778; End: 4887 Strand: -

Full Sequence      

MSIHRLVKYLFTVLILVSYIGLVLFSISSNKEALQKNSYWDWYRNYVSQSSKGTFVNTGT
QEDPVALSESQGYGMLITLLAAQKGYTKEDQFMRLFHYYKANRISEQNTLMKWQQKKSPN
GWSSVDQNNATDGDLDIAYALIQADKLWPDSFEQYGLAAQQLLASIKAHNYSEKTGLLTV
GNWATVDSKAETMIRTSDMIPHYFETFAAYTKDPFWTKLEAHTTKALTQMSQQTSTGLLP
DFAWVTASSITPLKPNEIAGKNDGDYAYNAARVPLRLADSDKPEVKKTLDKMLMFFEKQP
VIYGGYTLKGKPLVKNQSNSFSAPILYATKGDKNFSNLYASQRWIFNYAIVGKDYYGDTL
KVLVLLKLY

Enzyme Prediction     

No EC number prediction in MGYG000000681_00232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	366	2.9e-70	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3405	BcsZ	4.34e-19	16	315	5	295	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	5.33e-15	37	359	5	310	Glycosyl hydrolases family 8.
PRK11097	PRK11097	3.32e-11	40	343	28	326	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW56350.1	3.36e-270	1	369	1	369
QIW57933.1	3.36e-270	1	369	1	369
ATC61807.1	5.56e-269	1	369	1	369
CEN28757.1	8.83e-211	1	369	1	369
QIW50943.1	1.77e-188	111	369	1	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	6.28e-34	40	362	66	396	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.97e-22	38	366	33	375	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.48e-22	38	366	39	381	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1KWF_A	1.84e-21	26	366	15	350	ChainA, Endoglucanase A [Acetivibrio thermocellus]
1CEM_A	4.66e-21	26	366	15	350	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	2.48e-33	40	362	66	396	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	8.04e-22	36	366	88	431	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	9.85e-21	26	366	47	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37701	6.41e-13	29	366	57	383	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1
P37699	6.52e-12	67	366	97	383	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999637	0.000106	0.000023	0.000001	0.000000	0.000265

TMHMM  Annotations     

start	end
7	29