CAZyme Information: MGYG000000681_00590

Basic Information

• Species: Lactococcus_A raffinolactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A raffinolactis
• CAZyme ID: MGYG000000681_00590
• CAZy Family: GH65
• CAZyme Description: Maltose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		27713.2	4.6929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000681	1472277	MAG	Kazakhstan	Asia

• Gene Location: Start: 4397; End: 5131 Strand: -

Full Sequence      

MAKHSRADLNVTAEELAKWSEIVDKMYYPYDEKEGVFVQHDGFMDKDLRPVSALDATDLP
LNQNWSWDKILRSPFIKQADVLQGIYFFGNQFSLEEKRRNFDFYEPMTVHESSLSPSIHA
ILAAELGKEAKAVEMYGRTARLDLDNYNNDTEDGLHITSMTGSWLAIVQGFAQMKTWDGK
LSFAPFLPSDWTGYTFHINYRGRLLKIEVTENVTVSLLSGEALNLEVYGQSVELTSSYTV
KVGG

Enzyme Prediction     

EC	2.4.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	6	177	3.5e-64	0.4596774193548387

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13807	PRK13807	2.31e-172	6	242	519	756	maltose phosphorylase; Provisional
COG1554	ATH1	1.47e-117	2	243	524	769	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	1.17e-89	5	181	208	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03633	Glyco_hydro_65C	3.25e-19	185	233	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.
COG3459	COG3459	7.27e-04	129	209	935	1017	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW51138.1	4.35e-172	1	244	512	755
QIW60292.1	4.35e-172	1	244	512	755
QIW53554.1	4.35e-172	1	244	512	755
ATC62006.1	4.35e-172	1	244	512	755
QIW58148.1	4.35e-172	1	244	512	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H54_A	8.74e-96	9	229	524	745	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
3WIQ_A	9.83e-35	9	215	527	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	6.49e-30	9	241	516	759	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	6.49e-30	9	241	516	759	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E6ENP7	2.46e-110	9	234	542	768	Maltose phosphorylase OS=Enterococcus faecalis (strain TX4000 / JH2-2) OX=749493 GN=malP PE=1 SV=1
O06993	3.99e-98	1	234	512	746	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1
Q8L164	1.17e-51	9	234	542	768	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	9.71e-45	6	242	520	757	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
Q8L163	9.21e-38	11	235	547	773	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000681_00590.