CAZyme Information: MGYG000000681_01295

Basic Information

• Species: Lactococcus_A raffinolactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus_A; Lactococcus_A raffinolactis
• CAZyme ID: MGYG000000681_01295
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		34947.11	6.0906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000681	1472277	MAG	Kazakhstan	Asia

• Gene Location: Start: 644; End: 1579 Strand: +

Full Sequence      

MNYMTHTIEPWMPVGATKPKDDIAKIAASKGWQRLEIDRATQGTNADNLVVSLSSSDIVV
HQFPSYLPLEFEENFQRAVQLTGAKFIILIHDFEPLRLSDRQDSKREYALLRYSDGLVVH
TSEMAEAIALPIPIFILGLFDYLTDSQIPDRKPNHDLIFAGTLTKATWLKTFPLPIKVFG
NLPRKWSAADLPPTLNLQTILPQDTAPTELSDGVGLVWDSDEMDKTYYQAYQRLNSPHKL
SLYLAAGLPVVIPAISPFSDFVISNKIGISDLSELPISFTFDKDNLSHISKSIRTGKHTI
TLLKKIETFYS

Enzyme Prediction     

No EC number prediction in MGYG000000681_01295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	16	307	3e-62	0.9627329192546584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.09e-75	2	307	3	330	sugar transferase.
cd03794	GT4_WbuB-like	1.58e-08	81	270	121	343	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIW51525.1	2.12e-226	1	311	1	313
QIW58500.1	4.28e-226	1	311	1	313
QIW60691.1	2.47e-225	1	311	1	313
QIW55823.1	2.47e-225	1	311	1	313
QIW53762.1	1.49e-223	4	311	1	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QKW_A	1.68e-17	20	295	23	307	Structureof Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_B Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_C Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis],3QKW_D Structure of Streptococcus parasangunini Gtf3 glycosyltransferase [Streptococcus parasanguinis]
3RHZ_A	1.79e-17	20	295	31	315	Structureand functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis],3RHZ_B Structure and functional analysis of a new subfamily of glycosyltransferases required for glycosylation of serine-rich streptococcal adhesions [Streptococcus parasanguinis]
4W6Q_A	2.02e-16	23	303	26	322	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2UR93	1.81e-19	23	305	24	318	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
P37749	2.58e-17	37	306	44	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B5A7L9	8.99e-17	20	295	21	305	Glucosyltransferase 3 OS=Streptococcus parasanguinis OX=1318 GN=gtf3 PE=1 SV=1
A0A0M3KKZ0	1.09e-15	23	303	24	320	Glucosyltransferase 3 OS=Streptococcus agalactiae serotype III (strain COH1) OX=342616 GN=gtf3 PE=1 SV=2
Q9AEU1	9.60e-15	20	268	21	280	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000681_01295.