CAZyme Information: MGYG000000682_00608

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4334
• CAZyme ID: MGYG000000682_00608
• CAZy Family: GH88
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000682_9|CGC1	44418.82	6.9125

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000682	2426258	MAG	Kazakhstan	Asia

• Gene Location: Start: 31784; End: 32956 Strand: -

Full Sequence      

MVRRLFLGLIAGLCCMGANGQQLDVERQLDYCRKQVARSLRELMPIDYTMTPRNIGLEQK
HWNLRTVKTPEEWCAGFYPGVLWMCGQREEAAKYTKELEYLAYSPVYDHDLGFIMIGSFL
KGCEITADEHYRDVLLAAADTLATLYNPRVGTLLSWPRNVKIFGGHNTIIDNMINLELLL
FSGKKENVDIAIHHADTTMKHQFRPDGTVYHVAVYDPVTGKHLRNCTHQGFGDNTLWARG
QAWAIYGYTMMYRYTRAQRYLDFAQKVADVMIKQLPADGIPWWDMGDPMIPQSFRDASAA
AIMASGLVELSSYTGRDGKDTQKAASYLSMAKTILSTLSGDEYQSREKNPAFLMHSVGNM
PAGTEVDYSINYADYYYVEALLRLEKVYRH

Enzyme Prediction     

No EC number prediction in MGYG000000682_00608.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	69	384	1.5e-102	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.13e-10	50	307	5	264	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	6.05e-05	242	340	471	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT34123.1	3.36e-141	12	387	11	398
QCD37075.1	1.52e-140	24	387	19	391
QUU00175.1	1.92e-140	12	387	11	398
ALA72154.1	3.02e-140	12	387	11	398
QEW35632.1	3.02e-140	12	387	11	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	3.34e-69	2	387	1	391	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	1.57e-48	72	386	41	366	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	8.44e-48	72	386	41	366	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	6.08e-38	63	386	58	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	6.19e-38	63	386	59	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	1.50e-73	1	387	1	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	8.61e-48	72	386	41	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	1.76e-40	22	386	27	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8DR77	1.68e-39	63	386	57	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	3.39e-37	63	386	59	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000229	0.999143	0.000161	0.000151	0.000144	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000682_00608.