CAZyme Information: MGYG000000682_00875

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4334
• CAZyme ID: MGYG000000682_00875
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
141		16345.82	6.8346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000682	2426258	MAG	Kazakhstan	Asia

• Gene Location: Start: 8404; End: 8829 Strand: +

Full Sequence      

MAVFMFMALHVVSVHAQIPRQSVHWDDKSLVFDGKRVVPVMGEVHYSRIPQDEWTDEVRK
MKEGGVTVVATYVFWNHVEEVEGIYNWSGQRNLRAFLEVCKQQDMPVVLRLGPFCHGEVR
NGGIPDWMFAKGCKMREENHT

Enzyme Prediction     

No EC number prediction in MGYG000000682_00875.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	30	139	3.7e-45	0.3550488599348534

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	6.12e-34	29	141	1	114	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.42e-24	3	139	10	147	beta-galactosidase; Provisional
COG1874	GanA	2.89e-12	26	131	4	101	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	6.06e-05	50	131	8	79	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37835.1	1.17e-61	22	141	27	146
AGB28883.1	1.05e-55	20	139	342	461
QVJ80561.1	8.39e-44	34	139	62	167
ADE81979.1	8.39e-44	34	139	62	167
BCA48705.1	7.11e-43	26	131	40	145

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IK6_A	1.21e-24	22	139	7	125	ChainA, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
3W5F_A	1.21e-24	22	139	7	125	ChainA, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
5GSL_A	1.07e-23	22	128	5	115	Glycosidehydrolase A [Pyrococcus horikoshii OT3],5GSL_B Glycoside hydrolase A [Pyrococcus horikoshii OT3]
5GSM_A	3.70e-23	22	128	3	113	Glycosidehydrolase B with product [Thermococcus kodakarensis KOD1],5GSM_B Glycoside hydrolase B with product [Thermococcus kodakarensis KOD1]
6EON_A	2.48e-20	29	139	34	145	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6ZJJ0	3.48e-26	23	128	33	138	Beta-galactosidase 11 OS=Oryza sativa subsp. japonica OX=39947 GN=Os08g0549200 PE=2 SV=1
Q5Z7L0	1.23e-23	16	139	15	139	Beta-galactosidase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0573600 PE=2 SV=1
Q9SCV1	1.71e-23	21	128	39	146	Beta-galactosidase 11 OS=Arabidopsis thaliana OX=3702 GN=BGAL11 PE=2 SV=1
Q9FFN4	2.29e-23	21	128	30	137	Beta-galactosidase 6 OS=Arabidopsis thaliana OX=3702 GN=BGAL6 PE=2 SV=1
Q8GX69	3.17e-23	22	139	24	142	Beta-galactosidase 16 OS=Arabidopsis thaliana OX=3702 GN=BGAL16 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000725	0.998383	0.000190	0.000249	0.000216	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000682_00875.