CAZyme Information: MGYG000000682_01088

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA4334
• CAZyme ID: MGYG000000682_01088
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43070.04	8.5952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000682	2426258	MAG	Kazakhstan	Asia

• Gene Location: Start: 40468; End: 41586 Strand: +

Full Sequence      

MKKIIVFALGATMMAQATMAQTKQEVITAIEKVNDYWQSHNSARCRGFWDNAAYFTGNQE
VYKLTGKKQYLDYSVEWAEYNRWKGATQTDKSKWLYKTYGEGMNHVLFADWQICFQVYID
LYKQEHRAERLQRALEVMCYQASTKDKDYWWWSDALYMGLPIFTKLYTVTHDQKLLDKQY
ECFCWTDSLLFDKDEQLYYRDGKYVYPKVKTACNGGKSFWARGAGWVLAGLAKVLQDLPK
DSKYRAMYVDRFQQLAAGVARCQQPEGYWTRSLLCPDDAPGYETSGTAFFTYGLLWGVNN
GLLSAKQYQPTIDKAWKYLYETALQPDGSIGYVQPIGEKPDPTRTVNAKSQAPFGTGAWL
LAACEYTKYIKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	367	2.3e-73	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.07e-82	30	369	2	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.63e-39	13	368	10	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79822.1	2.52e-162	1	372	1	371
ADE82673.1	5.54e-159	1	370	1	369
QQT78026.1	3.21e-157	5	372	10	377
QRP56730.1	3.21e-157	5	372	10	377
ASM65438.1	3.21e-157	5	372	10	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	3.41e-154	25	371	32	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.37e-138	21	371	11	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	4.30e-54	49	368	53	368	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	4.81e-14	46	329	38	323	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.99e-13	46	329	28	313	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	2.80e-53	49	368	60	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	5.92e-52	49	368	58	374	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	4.02e-41	150	365	199	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	2.64e-13	46	329	38	323	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000345	0.998960	0.000183	0.000167	0.000152	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000682_01088.