CAZyme Information: MGYG000000685_00659

Basic Information

• Species: CAG-590 sp900552885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900552885
• CAZyme ID: MGYG000000685_00659
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1322	MGYG000000685_9|CGC2	145491.2	4.8444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000685	2863940	MAG	Kazakhstan	Asia

• Gene Location: Start: 23807; End: 27775 Strand: -

Full Sequence      

MKKNRKKQIIAMAMATTMAFTLAPVPQQPWCIQAKAEQAINNMINAKGAYKFDPTSTWDN
NKGKENNVEITTDSVPQDGTMLVMDVLLPEKEGNAPAFNGSMKAVGILRLGSDWNWVQSN
VTPELKSADFKDKVEIDGTTYYKASVKIPFADTVGANDADGNWNSNMPFAQAVTEPVNAV
TVQFAGYQCDYEGDIAVANAELTHTEGEAKQTALKTWDFTEDADSWEYAEGWEYKYTGGA
SKVEAVDGRLQIGVDYSKDSAESWSQLCVRRWGNVDIDSANEMTMDFYYKEKNMTKGGFA
IKATLQGDEGEATLAEVNVSLDLTQAEDAGNGWKKVKVSLPFDSAISGTCCNIAIGIVGK
NTDYAGDVALDDIILLKKESTDTSVDSTKIADVNKKAVVITDSQLVTNTSEKEEKIAITK
EVSLVDPNSSINTKAVYSYLKAMGESKSVIYGHQNDTWRKAGSKDLSNSDTKDVTGSISG
IVGIDGLSLTGNEYSASEYNAAFKPETALPETPAGNVQAAALLTNQNIKEGAIITMSLHM
PNFSVVKENENYTEGDPTYARYDFSGYSPNNLKGNVMNQILPGGQYNDKFNAYLDMVADY
AKQVDGTILFRPFHENTGSWFWWGAAFCDAATYKNVWKYTVEYLRDEKDVHNLLYVYGPG
SEAANVEEYGERYPGDAYVDMVGLDIYNDAPTEDNNNTWFKTFRNSVGIVQEFAKDHEKL
MAVTETGIRNETQKSENQTALLSTGNQDKDWYRNVLNAISETDASYFLLWANFGKKDGYY
TPYVDKVNKDGSLHGHEMLDAFLAFYNDPRTVFASQQKTVLQDIDNTLKEVQNKDAEAKI
EGYIVSPVARDRILDGITVKAKVNQAGEEDKITVTLKAKQEKTVDAVKTGKYYVAELSRE
DIVSLGEDNGTITLAANGTVLDQIGVIFNKEKPKEDPYEIDGFENYSGVDSLLTAAWTTN
KASGCTIKLGLDKEKALDGDYAMKFDYVEGKGGWAGATIAKEVDWSACNALQFYTIPDGN
NQKVVVQITANGMVYEAYMNTYKEYCNTKEPLKVTIPFEEFCARDTTGNPKGGLVSDKGK
IESVGLWVNAVDDSEAMTEEGVSGTIYYDKITAVKDTVEGVVIKSAKEVVKPNEKTDSDT
TEQPKPTEQPGSTEVPKSTEPVTTVSGTTQAVNKQENPLVKDNDEVTDGNNRYQVLSVEG
KTVAFCAPTRKNVTSIVIPDTVTINGQIYQVVSIAKNACKNCKKLNKIVIGKNITVIGKN
AFKNCKNVKKVIVKTKKLKSVGRNAFKGLNKKARIKVPASKYKKYQKLFQKKGQPKGVRI
IK

Enzyme Prediction     

No EC number prediction in MGYG000000685_00659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	425	752	9.4e-55	0.8382838283828383
CBM23	940	1095	4.7e-30	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.87e-30	425	760	1	298	Glycosyl hydrolase family 26.
COG4124	ManB2	4.67e-22	583	727	157	296	Beta-mannanase [Carbohydrate transport and metabolism].
pfam13306	LRR_5	3.41e-09	1212	1265	12	56	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.
sd00036	LRR_3	3.31e-08	1211	1265	14	59	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
pfam13306	LRR_5	3.79e-07	1212	1265	80	123	Leucine rich repeats (6 copies). This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ93186.1	5.55e-252	177	1122	187	1115
ASU28432.1	2.31e-251	177	1122	234	1162
ANU75629.1	2.31e-251	177	1122	234	1162
QJU14275.1	1.21e-250	177	1122	187	1115
AEY67866.1	3.67e-228	78	1114	254	1248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YN5_A	1.09e-49	424	830	51	433	Catalyticdomain of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase [Bacillus sp. JAMB750]
2BVT_A	2.29e-46	422	919	6	452	Thestructure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVT_B The structure of a modular endo-beta-1,4-mannanase from Cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases. [Cellulomonas fimi],2BVY_A The structure and characterization of a modular endo-beta-1,4-mannanase from Cellulomonas fimi [Cellulomonas fimi]
2X2Y_A	8.46e-45	422	919	6	452	Cellulomonasfimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi],2X2Y_B Cellulomonas fimi endo-beta-1,4-mannanase double mutant [Cellulomonas fimi]
1J9Y_A	1.01e-39	422	822	9	378	Crystalstructure of mannanase 26A from Pseudomonas cellulosa [Cellvibrio japonicus]
1R7O_A	1.26e-39	422	822	19	388	CrystalStructure of apo-mannanase 26A from Psudomonas cellulosa [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	1.41e-53	422	1038	40	624	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	1.23e-38	422	822	47	416	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P16699	1.11e-16	423	691	33	274	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
P49425	2.00e-14	602	727	300	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	2.70e-13	529	691	119	270	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000999	0.995976	0.002121	0.000439	0.000237	0.000192

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000685_00659.