CAZyme Information: MGYG000000685_02497

Basic Information

• Species: CAG-590 sp900552885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp900552885
• CAZyme ID: MGYG000000685_02497
• CAZy Family: GH2
• CAZyme Description: Evolved beta-galactosidase subunit alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		29136.78	5.8608

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000685	2863940	MAG	Kazakhstan	Asia

• Gene Location: Start: 1349; End: 2113 Strand: -

Full Sequence      

MKFAGLEYLNHPMELNIWRAPTDNDMYIKSEWKKARYDKAYTRAYTTEVVQGKHGVKITS
HASIVAETVQKILDVKITWAIDAAGKIDATIEATKDGEFPDLPRFGVRMFLDKKLADIRY
FGMGPQESYRDKHQAASHGLYRANVGDLHEDYIRPQENGSHYDCEYVELNNSRYGIVASA
EKAFSFNASYYTQEELEKKTHNYELIESDSVVFCVDYALNGIGSNSCGPVVLEQYRFDDV
LFRFQFTLIPYVKG

Enzyme Prediction     

EC	3.2.1.23

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart01038	Bgal_small_N	2.54e-91	2	248	20	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02929	Bgal_small_N	1.20e-86	1	248	19	230	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
PRK10340	ebgA	3.28e-55	5	254	751	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.21e-27	4	248	775	1024	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02293.1	1.08e-172	1	254	759	1012
CBL08191.1	3.88e-169	1	254	716	969
VCV23266.1	4.23e-169	1	254	759	1012
QUF79621.1	8.42e-169	1	254	759	1012
QQR00153.1	1.19e-168	1	254	759	1012

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	2.25e-25	15	248	793	1029	Structureof the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6SD0_A	7.42e-23	9	248	743	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	7.42e-23	9	248	742	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6ETZ_A	4.52e-22	15	236	737	973	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SE8_A	4.54e-22	15	236	758	994	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q [Arthrobacter sp. 32cB],6SE9_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactose bound in shallow mode [Arthrobacter sp. 32cB],6SEA_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactose bound in deep mode [Arthrobacter sp. 32cB],6ZJS_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with galactose [Arthrobacter sp. 32cB],6ZJT_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with lactulose [Arthrobacter sp. 32cB],6ZJU_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E441Q in complex with saccharose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	8.83e-70	4	249	757	998	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	3.44e-47	16	248	759	991	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
P23989	1.45e-25	2	235	773	1008	Beta-galactosidase OS=Streptococcus thermophilus OX=1308 GN=lacZ PE=3 SV=1
Q1G9Z4	4.90e-25	1	238	754	991	Beta-galactosidase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) OX=390333 GN=lacZ PE=3 SV=3
P06864	1.23e-24	79	254	826	1003	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000685_02497.