CAZyme Information: MGYG000000686_00049

Basic Information

• Species: UBA733 sp900767605
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; UBA733; UBA733 sp900767605
• CAZyme ID: MGYG000000686_00049
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587		65670.97	5.2291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000686	1824593	MAG	Kazakhstan	Asia

• Gene Location: Start: 51693; End: 53456 Strand: -

Full Sequence      

MPKFVDLTKKPYELNPAQITWVENTIASMDLETKFKQLFIDLTASKKEEDLKENMEKRAP
GGVRYNPGSAKDIYDHNRNVQKYSSIPCFVAANCESGGNGAFNGGTLVGCETKIAATNDL
HLAYELGEVSAKEASMVGVNTIFAPIVDIHHDFHNPVISNRTFGNDPEKVKAMSLEFLRG
IHSQGLLAAAKHFPGDGYDERDQHLAPVTNPLSQEEWGKSFGMVYSSLIQEGLDMVMVGH
ISLPSYAGKDANHPELAYRPATICPELINGLLKEKLGFNGLAVTDATHMVGFTCAGKRKD
LLPLAIASGMDMILFYNDYEEDLAFVAEGYEKGIFDEARLNDALRRILGLKAKLGYASFD
LEKDFPSFDEEKIKEVLKQDSVYTKEVAEKGITLVKDEDHLFPLTPEKYHRILLVGQEDE
NPFAFMMPKRGLTLAEQVKEKLEKEGFEVTIFESLMDKAKKLPPMEAFRLVGNVYNNKTP
IHDLTDHYDLVIQLAHFDSHNTVQRISWKLSKGTADVPWYVFELPVLFVSFCSPFHLFDV
PQVKNYINAYDKNVVTVDVLIDKLLGRGKFEGVSPVDAFCGTPNTTF

Enzyme Prediction     

No EC number prediction in MGYG000000686_00049.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	84	314	9.5e-46	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.84e-66	29	422	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.14e-59	31	350	2	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	7.17e-23	120	318	96	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.48e-15	22	446	38	454	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA10123.1	2.44e-195	5	585	2	587
CED94841.1	3.06e-193	5	587	2	586
QQJ89971.1	1.16e-192	5	585	3	584
ALC92197.1	4.69e-192	5	585	4	584
QEH09906.1	6.64e-192	5	585	3	584

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.19e-120	7	581	6	561	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	1.33e-41	1	461	53	505	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	4.77e-41	1	461	27	479	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.53e-41	1	461	57	509	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	5.46e-40	61	354	59	349	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	2.77e-115	5	585	2	562	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	7.27e-41	1	461	53	505	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	3.42e-25	81	361	93	390	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B7UYS5	7.22e-24	118	318	89	277	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1
Q9HZK0	7.22e-24	118	318	89	277	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000686_00049.