CAZyme Information: MGYG000000686_01424

Basic Information

• Species: UBA733 sp900767605
• Lineage: Bacteria; Firmicutes; Bacilli; RFN20; CAG-826; UBA733; UBA733 sp900767605
• CAZyme ID: MGYG000000686_01424
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		88787.89	6.8243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000686	1824593	MAG	Kazakhstan	Asia

• Gene Location: Start: 128; End: 2512 Strand: +

Full Sequence      

MAKKTKQQHQALTLRERCHLLHGNGGWKLHGCKRLGIEGIEMHDGPLGLRVCSPKEVDST
CYPAPCLLACSWDVELEKQIGRAIAEECALKGTDVLLAPGVNIKRNPLCGRNFEYLSEDP
LLSGKMGAAFIQGVQSNSIAACVKHFACNSQENYRFINDSIVDERAMHEIYLKAFEIVVK
EADPWSMMSAYNIVNGVHCSDNEYLLVDTLRDSWGYEGVVMSDWGGTYDPVYSHQHGLDV
EMPCYAKERTAELLRATKSGRLSLDKMTESADRVLNLISKIREGDKVARWDAQKCHELAV
KAAEESIVLLKNENNILPLSKTLMGACVIGAFAETPRYNGGGSSKVYTEHSISFLDAINR
ELPFARGYSFKPNSDSKALLFNAVDLASRSKTVLYFMGLPEEDESEGYDRETMNLPENQL
ALFDALYSVNPNIVVILSCGAPVVLPFRDRAKAILLTYLAGEGSGEALRDILSGECSPCG
KLAETWPIHESDVPSFGFYPGFQGQSIYKESIYVGYRYYLTSGVKVAYPFGHGLSYNRFS
YSLRCDSSHLETGKTIRVYANVTNKSSRPGKTVLELYAESPKGNAFKAKRVLVAFKKVAL
KEGETQVVSFDLNQSDFAIYDTETHAFQVEGGTYILALGTSSENIVSTLDLIVDGTRTLP
NLREKCPIYYAVPHGGFTQYDDEFETLLGRPLTLDKDRRERPFDRDSTMGDISWTAVGKK
RRKQFVKEHADWTPIQIKSGFDDAPIRQIAKDQNERDVRRLIDYANGHYIRGFIHGLIPT
KTRDFYADQKAKKK

Enzyme Prediction     

No EC number prediction in MGYG000000686_01424.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	243	7.1e-63	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.38e-66	34	352	57	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	1.70e-65	60	642	118	754	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	4.00e-55	307	516	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	9.17e-55	12	640	60	763	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.95e-36	58	277	84	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS53344.1	1.72e-190	12	723	10	732
AGS53563.1	2.23e-188	12	720	10	731
AGS53403.1	7.24e-180	6	771	6	782
QSX09143.1	5.83e-179	4	783	3	810
AEV59720.1	6.78e-179	12	734	23	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	9.01e-173	1	656	1	671	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.37e-157	1	655	1	665	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.01e-125	30	645	44	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.57e-124	30	645	44	705	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	3.19e-100	16	654	17	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.94e-172	1	656	1	671	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	7.73e-155	1	655	1	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	6.67e-153	1	655	1	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	4.57e-111	12	649	53	741	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	2.02e-106	12	660	18	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000686_01424.