CAZyme Information: MGYG000000687_00143

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerostipes
• CAZyme ID: MGYG000000687_00143
• CAZy Family: GH42
• CAZyme Description: Beta-galactosidase BgaP

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343		40302.5	7.2085

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000687	2211452	MAG	Kazakhstan	Asia

• Gene Location: Start: 40534; End: 41565 Strand: -

Full Sequence      

MAYGKNIRNILYGGDYNPEQWPEEVWQEDMRMMKKAHVNIVTLNVFSWATLQPSEDTYDF
SKLDKIMDYARENGLKVCLATSTGAHPAWMAHRHPDILRTEFNGTKRKFGGRHNSCPNST
TYRYYAQKLASKLAKRYKDYDNIVAWHISNEFGGECYCENCERAFRQWLKKKYKTLDAVN
RSFNTTFWGHTFYDWDEIVPPNLLSEHFAYDRTMFQGITLDYQRFNSDSMLECFQLEYDA
IKKETPDIPITTNLMGFYKPLDYQKWARSMDFISWDNYPAPDDSPAQIAMNHDLMRGIKN
QDSFVLMEQTPSVTNWLPYNKLKRPGEMRRLSYQAAAHGADAI

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH42	15	343	3.6e-143	0.8840970350404312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	3.15e-175	15	343	1	332	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	2.45e-129	8	343	14	347	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
smart00633	Glyco_10	1.15e-04	48	77	3	32	Glycosyl hydrolase family 10.
pfam14488	DUF4434	1.99e-04	11	170	8	151	Domain of unknown function (DUF4434).
pfam00150	Cellulase	5.99e-04	2	154	3	133	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ97846.1	3.46e-197	1	343	1	343
QNU68445.1	4.42e-190	1	343	1	343
BBF45276.1	1.30e-189	1	343	1	343
VCV21892.1	3.20e-188	1	343	1	345
AOZ94958.1	4.11e-188	1	343	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TTS_A	9.35e-163	10	343	9	342	ChainA, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTS_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_A Chain A, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_B Chain B, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_C Chain C, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_D Chain D, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_E Chain E, Beta-galactosidase [Niallia circulans subsp. alkalophilus],3TTY_F Chain F, Beta-galactosidase [Niallia circulans subsp. alkalophilus]
5E9A_A	6.00e-104	7	343	36	374	Crystalstructure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_B Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_C Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_D Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_E Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3],5E9A_F Crystal structure analysis of the cold-adamped beta-galactosidase from Rahnella sp. R3 [Rahnella sp. R3]
4OIF_A	3.09e-97	2	343	7	357	3Dstructure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_B 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus],4OIF_C 3D structure of Gan42B, a GH42 beta-galactosidase from G. [Geobacillus stearothermophilus]
4OJY_A	3.16e-97	2	343	8	358	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],4OJY_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]
5DFA_A	2.39e-96	2	343	7	357	3Dstructure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_B 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus],5DFA_C 3D structure of the E323A catalytic mutant of Gan42B, a GH42 beta-galactosidase from G. stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09HN2	1.37e-159	7	343	6	343	Beta-galactosidase BgaP OS=Planococcus sp. (strain L4) OX=377621 GN=bgaP PE=1 SV=1
Q9KI47	2.71e-154	7	343	6	344	Beta-galactosidase BgaA OS=Planococcus sp. (strain 'SOS Orange') OX=128803 GN=bgaA PE=1 SV=1
Q5FJ41	2.23e-125	7	343	4	342	Beta-galactosidase LacZ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=lacZ PE=1 SV=1
C6H178	5.00e-124	7	343	4	342	Beta-galactosidase LacA OS=Lactobacillus acidophilus OX=1579 GN=lacA PE=1 SV=1
D5JGG0	1.32e-117	5	343	3	338	Beta-galactosidase LacZ OS=Weizmannia coagulans OX=1398 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000687_00143.