CAZyme Information: MGYG000000690_00646

Basic Information

• Species: CAG-590 sp000431135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp000431135
• CAZyme ID: MGYG000000690_00646
• CAZy Family: GH5
• CAZyme Description: Endoglucanase C307

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		30152.02	5.0321

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000690	2764780	MAG	Kazakhstan	Asia

• Gene Location: Start: 43643; End: 44425 Strand: -

Full Sequence      

MLDLHKAYGYDFNDAGNNEKNNLFSNESLQQRFLNLWIQIAEHFGHYDNVAFELLNEVVE
KENAQAWNNLIRKTVTAIRQITNDTPVIYGGIQWNSVKTLKLLEVPMDSNTIFTFHFYEP
LLFTHQKAHWVEKMDKNKTIEYPGQMQDYRKESEVLGYQGEVVIKAHSNTMGEEFIREMV
QEAVQAAANAGVGLYCGEFGVIDQAPLIDTLRWFKDVNTVFRENHIGCAVWNYKGMDFGL
IDKHYDSIRENLISIWTKGE

Enzyme Prediction     

EC	3.2.1.-	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	238	4.8e-95	0.7539936102236422

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.21e-17	1	237	82	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.64e-05	1	97	133	234	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEV59731.1	1.51e-129	1	257	83	339
QNM02456.1	4.81e-128	1	258	82	339
AEV59739.1	5.08e-125	1	258	82	339
QQA00641.1	4.63e-116	1	258	82	339
AEB15411.1	5.51e-100	1	258	82	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	1.18e-50	1	258	86	340	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	3.31e-50	1	258	86	340	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
7EC9_A	2.78e-22	2	242	95	314	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	3.83e-22	2	242	95	314	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3AMC_A	5.35e-22	27	258	105	304	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	4.60e-50	1	258	86	340	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	4.60e-50	1	258	86	340	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	9.13e-50	1	258	86	340	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	4.89e-39	1	226	86	286	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P25472	1.57e-17	32	217	133	323	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000690_00646.