CAZyme Information: MGYG000000690_00688

Basic Information

• Species: CAG-590 sp000431135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-590; CAG-590 sp000431135
• CAZyme ID: MGYG000000690_00688
• CAZy Family: GH166
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000000690_10|CGC2	37638.11	10.1519

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000690	2764780	MAG	Kazakhstan	Asia

• Gene Location: Start: 18301; End: 19266 Strand: +

Full Sequence      

MNAKEMLGCCLIFAAIILAQLPVQRKAKLADEVMGRTGVSKKSKYFWKKILILTWMFSLF
LGILAGPCAVDAKNQKEKKEYGVFLSIDSSQIKKLYGYRLVVIDAQYFSAKDIRTLHKKG
VKVYTYLNVGSIENFRYYYKKYEYLTIGNYENWEEEKWVDVSNKDWQKFMGKLSKKLLKK
GVDGFFIDNCDVYDYAKTKKNFKGLAKILKNIKRLGKGVMINGGDVFVTKYRKTYGSAKD
IMTAVNQESVWSSIRFETGTFGKQPKDVRKYFSDYVQKCKKDRMEVYLLEYTKDKKLIRQ
IKQYCRKNKFHYYISDSIELD

Enzyme Prediction     

No EC number prediction in MGYG000000690_00688.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH166	100	316	2.1e-61	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03537	Glyco_hydro_114	4.46e-18	101	194	20	113	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
COG3868	COG3868	2.32e-17	97	297	79	280	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
COG2342	COG2342	8.47e-12	97	294	43	254	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	7.38e-04	113	195	64	157	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08521.1	3.38e-191	39	321	1	283
VCV23723.1	2.28e-189	39	321	1	283
CBL11057.1	2.28e-189	39	321	1	283
AOZ95737.1	6.98e-84	39	320	3	285
QHI71547.1	4.28e-79	59	321	10	272

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24
51	70